Sirt7 (NM_153056) Mouse Tagged ORF Clone

CAT#: MR203221

  • TrueORF®

Sirt7 (Myc-DDK-tagged) - Mouse sirtuin 7 (silent mating type information regulation 2, homolog) 7 (S. cerevisiae) (Sirt7)

ORF Plasmid: DDK tGFP



  "NM_153056" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,081.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


SIRT7 Antibody - middlel region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms MGC31235; MGC37560
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203221 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCATCACCCGTTTGCATGAGCAAAAGCTGGTGCAACACGTGGTGTCTCAGAACTGTGATGGGCTCC
ACCTGCGGAGTGGGTTGCCCCGGACCGCCATCTCAGAGCTCCATGGGAATATGTATATTGAAGTCTGCAC
CTCCTGCATCCCTAACAGAGAGTATGTACGAGTGTTTGATGTGACTGAGCGTACTGCCCTTCACCGACAC
CTGACAGGCCGGACCTGCCACAAGTGCGGGACCCAGCTTCGGGATACCATTGTGCACTTTGGGGAGAGGG
GGACATTAGGGCAGCCTCTGAACTGGGAGGCAGCGACCGAGGCTGCTAGCAAAGCAGACACAATCCTGTG
TTTAGGGTCCAGCTTGAAGGTACTAAAGAAATATCCCCGCCTCTGGTGCATGACGAAGCCTCCAAGCCGT
CGACCCAAACTCTACATCGTGAACCTGCAGTGGACCCCGAAGGATGACTGGGCTGCCCTGAAACTCCATG
GGAAGTGTGATGATGTCATGCAACTCCTCATGAATGAACTGGGCCTGGAGATTCCTGTCTACAACCGGTG
GCAGGATCCAATCTTCTCCTTGGCGACCCCCCTCCGTGCTGGTGAAGAAGGCAGCCACAGTAGGAAGTCA
CTATGCAGAAGCAGAGAAGAAGCCCCACCTGGGGACCAGAGTGACCCCCTTGCCTCAGCTCCCCCTATCC
TAGGAGGCTGGTTTGGCAGGGGTTGTGCCAAGCGTGCAAAAAGGAAGAAAGTGGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203221 protein sequence
Red=Cloning site Green=Tags(s)

MSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISELHGNMYIEVCTSCIPNREYVRVFDVTERTALHRH
LTGRTCHKCGTQLRDTIVHFGERGTLGQPLNWEAATEAASKADTILCLGSSLKVLKKYPRLWCMTKPPSR
RPKLYIVNLQWTPKDDWAALKLHGKCDDVMQLLMNELGLEIPVYNRWQDPIFSLATPLRAGEEGSHSRKS
LCRSREEAPPGDQSDPLASAPPILGGWFGRGCAKRAKRKKVA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_153056
ORF Size 759 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 1715 bp
RefSeq ORF 1209 bp
Locus ID 209011
UniProt ID Q8BKJ9
MW 28.4 kDa
Gene Summary NAD-dependent protein deacetylase that specifically mediates deacetylation of histone H3 at 'Lys-18' (H3K18Ac). In contrast to other histone deacetylases, displays selectivity for a single histone mark, H3K18Ac, directly linked to control of gene expression. H3K18Ac is mainly present around the transcription start site of genes and has been linked to activation of nuclear hormone receptors. SIRT7 thereby acts as a transcription repressor. Moreover, H3K18 hypoacetylation has been reported as a marker of malignancy in various cancers and seems to maintain the transformed phenotype of cancer cells. These data suggest that SIRT7 may play a key role in oncogenic transformation by suppresses expression of tumor suppressor genes by locus-specific deacetylation of H3K18Ac at promoter regions (By similarity). Required to restore the transcription of ribosomal RNA (rRNA) at the exit from mitosis. Promotes the association of RNA polymerase I with the rDNA promoter region and coding region. Stimulates transcription activity of the RNA polymerase I complex. May also deacetylate p53/TP53 and promotes cell survival, however such data need additional confirmation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...