Cdk7 (BC004605) Mouse Tagged ORF Clone

CAT#: MR204375

  • TrueORF®

Cdk7 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) (cDNA clone MGC:6069 IMAGE:3585145)

ORF Plasmid: DDK tGFP



  "BC004605" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2400.00

CNY 6365.00


货期*
现货

规格
    • 10 ug

Product images

推荐一起购买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
    • 5 ml

CNY 6840.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AI323415; AI528512; C230069N13; Cdkn7; Crk4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204375 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGACGTGAAGTCTCGAGCGAAGCGCTATGAGAAACTGGACTTCCTCGGAGAGGGACAGTTTG
CGACGGTCTATAAGGCCAGGGACAAGAACACCAACCAAATCGTCGCCATTAAGAAAATCAAACTTGGACA
CAGGTCAGAAGCTAAGGATGGAATAAATAGAACAGCCTTAAGGGAGATAAAGCTCTTACAGGAACTAAGT
CATCCAAATATAATTGGTCTCCTTGATGCATTTGGACATAAGTCTAACATTAGCCTTGTCTTTGATTTTA
TGGAAACTGACCTCGAGGATCTGAAACCAAACAACTTGTTGTTAGATGAGAATGGAGTTCTGAAACTGGC
AGATTTTGGCCTGGCCAAATCATTTGGGAGCCCCAATAGGGCTTACACACATCAAGTTGTGACCAGATGG
TACCGGGCTCCTGAGTTATTGTTTGGAGCTAGGATGTATGGTGTGGGAGTAGACATGTGGGCTGTTGGTT
GTATATTAGCAGAATTGCTTCTAAGGGTTCCATTTTTGCCTGGAGATTCAGATCTTGATCAGCTAACAAG
GATATTTGAAACTCTGGGTACACCAACTGAAGAGCAGTGGCCTGACATGTGTAGTCTTCCCGATTATGTG
ACATTTAAGAGTTTCCCTGGGGTCCCACTGCAGCACATCTTCATCGCGGCTGGGGACGACCTGCTGGAGC
TCATCCAAGGCCTGTTCTTATTTAACCCGTGTACGCGGACCACAGCCTCACAGGCATTGAAGACCAAGTA
CTTCAGTAACCGCCCCGGGCCAACACCTGGATGCCAGCTCCCGCGACCAAACTGTCCGGTGGAGGCATTA
AAGGAACCGGCGAATCCAACCGTGGCAACAAAGCGGAAAAGAGCAGAGGCCTTAGAACAAGGAATATTGC
CCAAGAAGCTCATTTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204375 protein sequence
Red=Cloning site Green=Tags(s)

MAVDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS
HPNIIGLLDAFGHKSNISLVFDFMETDLEDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRW
YRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYV
TFKSFPGVPLQHIFIAAGDDLLELIQGLFLFNPCTRTTASQALKTKYFSNRPGPTPGCQLPRPNCPVEAL
KEPANPTVATKRKRAEALEQGILPKKLIF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN BC004605
ORF Size 927 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC004605, AAH04605
RefSeq Size 1170 bp
RefSeq ORF 929 bp
Locus ID 12572
MW 34.6 kDa
Gene Summary Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...