NRAS (NM_002524) Human Tagged ORF Clone
CAT#: RC202681
NRAS (Myc-DDK-tagged)-Human neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS)
ORF Plasmid: tGFP
"NM_002524" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3600.00
CNY 3705.00
Cited in 2 publications. |
CNY 300.00
CNY 1999.00
CNY 2700.00
CNY 6840.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ALPS4; CMNS; N-ras; NCMS; NRAS1; NS6 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202681 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTGAGTACAAACTGGTGGTGGTTGGAGCAGGTGGTGTTGGGAAAAGCGCACTGACAATCCAGCTAA TCCAGAACCACTTTGTAGATGAATATGATCCCACCATAGAGGATTCTTACAGAAAACAAGTGGTTATAGA TGGTGAAACCTGTTTGTTGGACATACTGGATACAGCTGGACAAGAAGAGTACAGTGCCATGAGAGACCAA TACATGAGGACAGGCGAAGGCTTCCTCTGTGTATTTGCCATCAATAATAGCAAGTCATTTGCGGATATTA ACCTCTACAGGGAGCAGATTAAGCGAGTAAAAGACTCGGATGATGTACCTATGGTGCTAGTGGGAAACAA GTGTGATTTGCCAACAAGGACAGTTGATACAAAACAAGCCCACGAACTGGCCAAGAGTTACGGGATTCCA TTCATTGAAACCTCAGCCAAGACCAGACAGGGTGTTGAAGATGCTTTTTACACACTGGTAAGAGAAATAC GCCAGTACCGAATGAAAAAACTCAACAGCAGTGATGATGGGACTCAGGGTTGTATGGGATTGCCATGTGT GGTGATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202681 protein sequence
Red=Cloning site Green=Tags(s) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ YMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIP FIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NM_002524 |
ORF Size | 567 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_002524.5 |
RefSeq Size | 4454 bp |
RefSeq ORF | 570 bp |
Locus ID | 4893 |
UniProt ID | P01111 |
Domains | ras, RAS, RHO, RAB |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, Axon guidance, B cell receptor signaling pathway, Bladder cancer, Chemokine signaling pathway, Chronic myeloid leukemia, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Thyroid cancer, Tight junction, VEGF signaling pathway |
MW | 21.2 kDa |
Gene Summary | This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated by a guanine nucleotide-exchange factor and inactivated by a GTPase activating protein. Mutations in this gene have been associated with somatic rectal cancer, follicular thyroid cancer, autoimmune lymphoproliferative syndrome, Noonan syndrome, and juvenile myelomonocytic leukemia. [provided by RefSeq, Jun 2011] |
Shipping | Ambient |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Novel MAPK/AKT-impairing germline NRAS variant identified in a melanoma-prone family.
,null,
Familial cancer
,PubMed ID 34215961
[NRAS]
|
MiR-124 governs glioma growth and angiogenesis and enhances chemosensitivity by targeting R-Ras and N-Ras
,Shi, Z;Chen, Q;Li, C;Wang, L;Qian, X;Jiang, C;Liu, X;Wang, X;Li, H;Kang, C;Jiang, T;Liu, LZ;You, Y;Liu, N;Jiang, BH;,
Neuro-oncology
,PubMed ID 24861879
[NRAS]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202681L1 | Lenti ORF clone of Human neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS), Myc-DDK-tagged |
CNY 6000.00 |
|
RC202681L2 | Lenti ORF clone of Human neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS), mGFP tagged |
CNY 6000.00 |
|
RC202681L3 | Lenti ORF clone of Human neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS), Myc-DDK-tagged |
CNY 6000.00 |
|
RC202681L4 | Lenti ORF clone of Human neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS), mGFP tagged |
CNY 6000.00 |
|
RG202681 | NRAS (tGFP-tagged) - Human neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS) |
CNY 5200.00 |
|
SC118574 | NRAS (untagged)-Human neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS) |
CNY 3600.00 |