Cytochrome b c1 complex subunit 9 (UQCR10) (NM_013387) Human Tagged ORF Clone
CAT#: RC202816
UQCR10 (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1
ORF Plasmid: tGFP
"NM_013387" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HSPC051; HSPC119; HSPC151; QCR9; UCCR7.2; UCRC |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202816 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGCCGCGACGTTGACTTCGAAGTTGTACTCCCTGCTGTTCCGCAGGACCTCCACCTTCGCCCTCA CCATCATCGTGGGCGTCATGTTCTTCGAGCGCGCCTTCGATCAAGGCGCGGACGCTATCTACGACCACAT CAACGAGGGGAAGCTGTGGAAACACATCAAGCACAAGTATGAGAACAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202816 protein sequence
Red=Cloning site Green=Tags(s) MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_013387 |
ORF Size | 189 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_013387.2 |
RefSeq Size | 934 bp |
RefSeq ORF | 192 bp |
Locus ID | 29796 |
UniProt ID | Q9UDW1 |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
MW | 7.3 kDa |
Gene Summary | UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM, Mar 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202816L1 | Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202816L2 | Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC202816L3 | Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC202816L4 | Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG202816 | UQCR10 (tGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1 |
CNY 2,800.00 |
|
SC115241 | UQCR10 (untagged)-Human ubiquinol-cytochrome c reductase, complex III subunit X (UQCR10), transcript variant 1 |
CNY 1,200.00 |
其它Cytochrome b c1 complex subunit 9产品