SEM1 (NM_006304) Human Tagged ORF Clone
CAT#: RC207564
SHFM1 (Myc-DDK-tagged)-Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1)
ORF Plasmid: tGFP
"NM_006304" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C7orf76; DSS1; ECD; PSMD15; SHFD1; Shfdg1; SHFM1; SHSF1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC207564 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCAGAGAAAAAGCAGCCGGTAGACTTAGGTCTGTTAGAGGAAGACGACGAGTTTGAAGAGTTCCCTG CCGAAGACTGGGCTGGCTTAGATGAAGATGAAGATGCACATGTCTGGGAGGATAATTGGGATGATGACAA TGTAGAGGATGACTTCTCTAATCAGTTACGAGCTGAACTAGAGAAACATGGTTATAAGATGGAGACTTCA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC207564 protein sequence
Red=Cloning site Green=Tags(s) MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_006304 |
ORF Size | 210 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006304.1, NP_006295.1 |
RefSeq Size | 509 bp |
RefSeq ORF | 213 bp |
Locus ID | 7979 |
UniProt ID | P60896 |
Domains | DSS1_SEM1 |
Protein Pathways | Homologous recombination, Proteasome |
MW | 8.3 kDa |
Gene Summary | The product of this gene has been localized within the split hand/split foot malformation locus SHFM1 at chromosome 7. It has been proposed to be a candidate gene for the autosomal dominant form of the heterogeneous limb developmental disorder split hand/split foot malformation type 1. In addition, it has been shown to directly interact with BRCA2. It also may play a role in the completion of the cell cycle. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC207564L1 | Lenti ORF clone of Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC207564L2 | Lenti ORF clone of Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1), mGFP tagged |
CNY 5,890.00 |
|
RC207564L3 | Lenti ORF clone of Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC207564L4 | Lenti ORF clone of Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1), mGFP tagged |
CNY 5,890.00 |
|
RG207564 | SHFM1 (tGFP-tagged) - Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1) |
CNY 2,800.00 |
|
SC111062 | SHFM1 (untagged)-Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1) |
CNY 1,200.00 |