Nck beta (NCK2) (NM_001004722) Human Tagged ORF Clone
CAT#: RC223926
- TrueORF®
NCK2 (Myc-DDK-tagged)-Human NCK adaptor protein 2 (NCK2), transcript variant 3
ORF Plasmid: tGFP
"NM_001004722" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | GRB4; NCKbeta |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC223926 representing NM_001004722
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAGAAGAAGTTATTGTGATAGCCAAGTGGGACTACACCGCCCAGCAGGACCAGGAGCTGGACATCA AGAAGAACGAGCGGCTGTGGTTGCTGGACGACTCCAAGACGTGGTGGCGGGTGAGGAACGCGGCCAACAG GACGGGCTATGTACCGTCCAACTACGTGGAGCGGAAGAACAGCCTGAAGAAGGGCTCCCTCGTGAAGAAC CTGAAGGACACACTAGCCCAGCGACTTCTCCGTGTCCCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC223926 representing NM_001004722
Red=Cloning site Green=Tags(s) MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKN LKDTLAQRLLRVP myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001004722 |
ORF Size | 249 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001004722.3, NP_001004722.1 |
RefSeq Size | 1795 bp |
RefSeq ORF | 252 bp |
Locus ID | 8440 |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance, ErbB signaling pathway, Pathogenic Escherichia coli infection, T cell receptor signaling pathway |
MW | 9.8 kDa |
Gene Summary | This gene encodes a member of the NCK family of adaptor proteins. The protein contains three SH3 domains and one SH2 domain. The protein has no known catalytic function but has been shown to bind and recruit various proteins involved in the regulation of receptor protein tyrosine kinases. It is through these regulatory activities that this protein is believed to be involved in cytoskeletal reorganization. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC223926L3 | Lenti-ORF clone of NCK2 (Myc-DDK-tagged)-Human NCK adaptor protein 2 (NCK2), transcript variant 3 |
CNY 5,890.00 |
|
RC223926L4 | Lenti-ORF clone of NCK2 (mGFP-tagged)-Human NCK adaptor protein 2 (NCK2), transcript variant 3 |
CNY 5,890.00 |
|
RG223926 | NCK2 (tGFP-tagged) - Human NCK adaptor protein 2 (NCK2), transcript variant 3 |
CNY 4,370.00 |
|
SC300760 | NCK2 (untagged)-Human NCK adaptor protein 2 (NCK2), transcript variant 3 |
CNY 3,990.00 |
其它Nck beta产品