ATG5 (NM_001286111) Human Tagged ORF Clone
CAT#: RC235557
- TrueORF®
ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 5
ORF Plasmid: tGFP
"NM_001286111" in other vectors (2)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | APG5; APG5-LIKE; APG5L; ASP; hAPG5; SCAR25 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC235557 representing NM_001286111
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAGATGACAAAGATGTGCTTCGAGATGTGTGGTTTGGACGAATTCCAACTTGTTTCACGCTATATC AGGATGAGATAACTGAAAGGGAAGCAGAACCATACTATACAGATTTGACCAGTTTTGGGCCATCAATCGG AAACTCATGGAATATCCTGCAGAAGAAAATGGATTTCGTTATATCCCCTTTAGAATATATCAGACAACGA CTGAAAGACCTTTCATTCAGAAGCTGTTTCGTCCTGTGGCTGCAGATGGACAGTTGCACACAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC235557 representing NM_001286111
Red=Cloning site Green=Tags(s) MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYTDLTSFGPSIGNSWNILQKKMDFVISPLEYIRQR LKDLSFRSCFVLWLQMDSCTH myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001286111 |
ORF Size | 273 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001286111.1, NP_001273040.1 |
RefSeq Size | 2890 bp |
RefSeq ORF | 276 bp |
Locus ID | 9474 |
UniProt ID | Q9H1Y0 |
Protein Families | Druggable Genome |
Protein Pathways | Regulation of autophagy, RIG-I-like receptor signaling pathway |
MW | 11.3 kDa |
Gene Summary | The protein encoded by this gene, in combination with autophagy protein 12, functions as an E1-like activating enzyme in a ubiquitin-like conjugating system. The encoded protein is involved in several cellular processes, including autophagic vesicle formation, mitochondrial quality control after oxidative damage, negative regulation of the innate antiviral immune response, lymphocyte development and proliferation, MHC II antigen presentation, adipocyte differentiation, and apoptosis. Several transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Sep 2015] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Novel protein complexes containing autophagy and UPS components regulate proteasome-dependent PARK2 recruitment onto mitochondria and PARK2-PARK6 activity during mitophagy
,null,
Cell Death & Disease
,PubMed ID 36357363
[ATG5]
|
RACK1 is an Interaction Partner of ATG5 and a Novel Regulator of Autophagy
,Erbil, S;Oral, O;Mitou, G;Kig, C;Durmaz-Timucin, E;Guven-Maiorov, E;Gulacti, F;Gokce, G;Dengjel, J;Sezerman, OU;Gozuacik, D;,
J. Biol. Chem.
,PubMed ID 27325703
[ATG5]
|
Documents
Product Manuals |
FAQs |
SDS |