PPP1A (PPP1CA) (NM_206873) Human Tagged ORF Clone
CAT#: RG216212
- TrueORF®
PPP1CA (tGFP-tagged) - Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2
ORF Plasmid: DDK
"NM_206873" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 4,240.00
CNY 4,370.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Synonyms | PP-1A; PP1A; PP1alpha; PPP1A |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG216212 representing NM_206873
Red=Cloning site Green=Tags(s) MSDSEKLNLDSIIGRLLEGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY PENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSME QIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDG YEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRN SAKAKK TRTRPLE - GFP Tag - V |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_206873 |
ORF Size | 858 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_206873.2 |
RefSeq Size | 1356 bp |
RefSeq ORF | 861 bp |
Locus ID | 5499 |
UniProt ID | P62136 |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Focal adhesion, Insulin signaling pathway, Long-term potentiation, Oocyte meiosis, Regulation of actin cytoskeleton, Vascular smooth muscle contraction |
Gene Summary | The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). This broadly expressed gene encodes the alpha subunit of the PP1 complex that associates with over 200 regulatory proteins to form holoenzymes which dephosphorylate their biological targets with high specificity. PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies suggest that PP1 is an important regulator of cardiac function and that PP1 deregulation is implicated in diabetes and multiple types of cancer. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2020] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC216212 | PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2 |
CNY 3,990.00 |
|
RC216212L3 | Lenti-ORF clone of PPP1CA (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2 |
CNY 5,890.00 |
|
RC216212L4 | Lenti-ORF clone of PPP1CA (mGFP-tagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2 |
CNY 5,890.00 |
|
SC308293 | PPP1CA (untagged)-Human protein phosphatase 1, catalytic subunit, alpha isozyme (PPP1CA), transcript variant 2 |
CNY 6,270.00 |