NEIL2 (NM_001135746) Human Tagged ORF Clone
CAT#: RG227701
- TrueORF®
NEIL2 (tGFP-tagged) - Human nei endonuclease VIII-like 2 (E. coli) (NEIL2), transcript variant 2
ORF Plasmid: DDK
"NM_001135746" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 4370.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | TurboGFP |
| Synonyms | NEH2; NEI2 |
| Vector | pCMV6-AC-GFP |
| E. coli Selection | Ampicillin (100 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RG227701 representing NM_001135746
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCAGAAGGGCCGTTGGTGAGGAAATTTCACCATTTGGTCTCCCCCTTTGTGGGTCAGCAGGTGGTCA AGACAGGGGGCAGCAGTAAGAAGCTACAGCCCGCCAGCCTGCAGTCTCTGTGGCTCCAGGACACCCAGGT CCATGGAAAGAAATTATTCCTTAGATTTGATCTAGATGAAGAAATGGGGCCCCCTGGCAGCAGCCCAACA CCAGAGCCTCCACAAAAAGAAGTGCAGAAGGAAGGGGCTGCGGACCCAAAGCAGGTCGGGGAGCCCAGCG GGCAGAAGACCCTTGATGGATCCTCACGGTCTGCAGAGCTCGTCCCCCAGGGCGAGGATGATTCTGAGTA TTTGGAGAGAGACGCCCCTGCAGGAGATGCTGGGAGGTGGCTGCGTGTCAGCTTTGGTTTGTTTGGCAGC GTTTGGGTGAACGATTTCTCCAGAGCCAAGAAAGCCAACAAGAGGGGGGACTGGAGGGACCCTTCCCCGA GGTTGGTCCTGCACTTTGGTGGTGGTGGCTTCCTGGCATTTTATAATTGTCAGTTGTCTTGGAGCTCTTC CCCGGTGGTCACACCCACCTGTGACATCCTGTCTGAGAAGTTCCATCGAGGACAAGCCTTAGAAGCTCTA GGCCAGGCTCAGCCTGTCTGCTATACACTGCTGGACCAGAGATACTTCTCAGGGCTAGGGAACATCATTA AGAATGAAGCCTTGTACAGAGCTGGGATCCATCCCCTTTCTCTCGGTTCAGTCCTGAGTGCCTCGCGTCG GGAGGTCCTGGTGGATCACGTGGTGGAGTTCAGTACAGCCTGGCTGCAGGGCAAGTTCCAAGGCAGACCG CAGCACACACAGGTCTACCAGAAAGAACAGTGCCCTGCTGGCCACCAGGTCATGAAGGAGGCGTTTGGGC CCGAAGATGGGTTACAGAGGCTCACCTGGTGGTGCCCGCAGTGCCAGCCCCAGTTGTCAGAGGAGCCAGA GCAGTGCCAGTTCTCC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG227701 representing NM_001135746
Red=Cloning site Green=Tags(s) MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPT PEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGS VWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEAL GQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRP QHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS TRTRPLE - GFP Tag - V |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NM_001135746 |
| ORF Size | 996 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_001135746.1, NP_001129218.1 |
| RefSeq Size | 2202 bp |
| RefSeq ORF | 999 bp |
| Locus ID | 252969 |
| UniProt ID | Q969S2 |
| Protein Families | Druggable Genome |
| Protein Pathways | Base excision repair |
| Gene Summary | This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This enzyme is primarily associated with DNA repair during transcription and acts prefentially on cytosine-derived lesions, particularly 5-hydroxyuracil and 5-hydroxycytosine. It contains an N-terminal catalytic domain, a hinge region, and a C-terminal DNA-binding domain with helix-two-turn-helix and zinc finger motifs. This enzyme interacts with the X-ray cross complementing factor 1 scaffold protein as part of a multi-protein DNA repair complex. A pseudogene of this gene has been identified. [provided by RefSeq, Mar 2017] |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC227701 | NEIL2 (Myc-DDK-tagged)-Human nei endonuclease VIII-like 2 (E. coli) (NEIL2), transcript variant 2 |
CNY 2400.00 |
|
| RC227701L3 | Lenti ORF clone of Human nei endonuclease VIII-like 2 (E. coli) (NEIL2), transcript variant 2, Myc-DDK-tagged |
CNY 5890.00 |
|
| RC227701L4 | Lenti ORF clone of Human nei endonuclease VIII-like 2 (E. coli) (NEIL2), transcript variant 2, mGFP tagged |
CNY 5890.00 |
|
| SC324951 | NEIL2 (untagged)-Human nei endonuclease VIII-like 2 (E. coli) (NEIL2), transcript variant 2 |
CNY 6270.00 |
