E3 (NC_001460) Virus Tagged ORF Clone
CAT#: VC100273
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040929
View other clones from "Virus" (35)
Need custom modification / cloning service?
Get a free quote
CNY 3800.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Type | Virus Tagged ORF Clone |
| Tag | Myc-DDK |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>The Viral ORF clone VC100273 represents NCBI reference of NP_040929 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTAACGGCGCCGCCGATCGCGCTAGGCTGCGCCACTTGGACCATTGCAGGCAGCCGCACTGCTTTG CTCGAGATATTTGCGTGTTCACCTACTTTGAGCTGCCAGAGGAGCATCCGCAGGGGCCGGCCCATGGGGT TCGAATCACTGTAGAGAAAGGCATCGATACACATTTGATCAAGTTCTTCACGAAGCGACCTCTGCTCGTC GAAAAAGATCAGGGGAACACTATTCTGACACTGTACTGTATCTGCCCTGTACCTGGGCTGCATGAGGATT TCTGCTGCCACCTGTGCGCCGAGTTTAACCATCTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100273 representing NP_040929
Red=Cloning sites Green=Tags MSNGAADRARLRHLDHCRQPHCFARDICVFTYFELPEEHPQGPAHGVRITVEKGIDTHLIKFFTKRPLLV EKDQGNTILTLYCICPVPGLHEDFCCHLCAEFNHL TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NC_001460 |
| ORF Size | 315 bp |
| OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NC_001460.1, NP_040929 |
| RefSeq ORF | 315 bp |
| Locus ID | 1460862 |
| MW | 12.1 kDa |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| VC100254 | Myc-DDK-tagged ORF clone of viral ORF for E1A gene product [Human adenovirus A], codon optimized for human cell expression, NP_040910 |
CNY 3800.00 |
|
| VC100255 | Myc-DDK-tagged ORF clone of viral ORF for E1B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040911 |
CNY 3800.00 |
|
| VC100256 | Myc-DDK-tagged ORF clone of viral ORF for E1B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040912 |
CNY 5890.00 |
|
| VC100257 | Myc-DDK-tagged ORF clone of viral ORF for IX gene product [Human adenovirus A], codon optimized for human cell expression, NP_040913 |
CNY 3800.00 |
|
| VC100258 | Myc-DDK-tagged ORF clone of viral ORF for IVa2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040914 |
CNY 5510.00 |
|
| VC100259 | Myc-DDK-tagged ORF clone of viral ORF for E2B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040915 |
CNY 17860.00 |
|
| VC100260 | Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040916 |
CNY 3800.00 |
|
| VC100261 | Myc-DDK-tagged ORF clone of viral ORF for E2B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040917 |
CNY 7700.00 |
|
| VC100262 | Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040918 |
CNY 4470.00 |
|
| VC100263 | Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040919 |
CNY 7030.00 |
|
| VC100264 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040920 |
CNY 6080.00 |
|
| VC100265 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040921 |
CNY 4090.00 |
|
| VC100266 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040922 |
CNY 3800.00 |
|
| VC100267 | Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040923 |
CNY 3800.00 |
|
| VC100268 | Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040924 |
CNY 13870.00 |
|
| VC100269 | Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040925 |
CNY 3800.00 |
|
| VC100270 | Myc-DDK-tagged ORF clone of viral ORF for E2A-L gene product [Human adenovirus A], codon optimized for human cell expression, NP_040926 |
CNY 5890.00 |
|
| VC100271 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040927 |
CNY 11880.00 |
|
| VC100272 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040928 |
CNY 3800.00 |
|
| VC100274 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040930 |
CNY 3800.00 |
|
| VC100275 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040932 |
CNY 3800.00 |
|
| VC100276 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040931 |
CNY 3800.00 |
|
| VC100277 | Myc-DDK-tagged ORF clone of viral ORF for L5 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040933 |
CNY 7030.00 |
|
| VC100278 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040934 |
CNY 3800.00 |
|
| VC100279 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040935 |
CNY 3800.00 |
|
| VC100280 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040936 |
CNY 3800.00 |
|
| VC100281 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_597783 |
CNY 3800.00 |
|
| VC100282 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_597784 |
CNY 3800.00 |
|
| VC100283 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640219 |
CNY 3800.00 |
|
| VC100284 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640220 |
CNY 3800.00 |
|
| VC100285 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640221 |
CNY 3800.00 |
|
| VC100286 | Myc-DDK-tagged ORF clone of viral ORF for U gene product, partial [Human adenovirus A], codon optimized for human cell expression, YP_002640222 |
CNY 3800.00 |
|
| VC100287 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640218 |
CNY 3800.00 |
|
| VC100288 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640223 |
CNY 3800.00 |
|
| VC100289 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640224 |
CNY 3800.00 |
