HCoV-OC43 N2 Gene Tagged ORF Clone
CAT#: VC100606
- TrueORF®
Myc-DDK-tagged ORF clone for N2 protein [Human coronavirus OC43], codon optimized for human cell expression, NP_937955
View other clones from "HCoV-OC43" (7)
Need custom modification / cloning service?
Get a free quote
CNY 3800.00
Product images

CNY 600.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100606 represents NCBI reference of NP_937955 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTACATCAGTGAACTGCTGCCACGATGGCATCTTCACGATCTGGGAGCAAGACCGCATGCTCAAAA CCAGCACAGCACCAATTCTGACCGAAAGTACTGGGTCTCTTGCGACTCGGCTCATGTCCATCCCCCGGCT TACACTCTCTATTGGGACCCAGGTTGCCATGCGATTGTTTCGGCTCGGGTTCCGGCTGGCTCGGTATTCC CTGAGGGTAACCATTCTCAAGGCGCAGGAAGGACTGCTGCTGATCCCGGACCTTCTTCGAGCGCACCCAG CGGAACCCCTGGTACAGGACCGCGTTGTGGAGCCTATCCTGGCCATCGAACCACTGCCCCTCGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100606 representing NP_937955
Red=Cloning sites Green=Tags MATSVNCCHDGIFTIWEQDRMLKTSTAPILTESTGSLATRLMSIPRLTLSIGTQVAMRLFRLGFRLARYS LRVTILKAQEGLLLIPDLLRAHPAEPLVQDRVVEPILAIEPLPLV TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_005147 |
ORF Size | 345 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_005147.1, NP_937955 |
RefSeq ORF | 345 bp |
Locus ID | 2648212 |
MW | 12.8 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100599 | Myc-DDK-tagged ORF clone for NS2a protein [Human coronavirus OC43], codon optimized for human cell expression, NP_937948 |
CNY 3800.00 |
|
VC100600 | Myc-DDK-tagged ORF clone for HE protein [Human coronavirus OC43], codon optimized for human cell expression, NP_937949 |
CNY 3656.00 |
|
VC100601 | Myc-DDK-tagged ORF clone for S protein [Human coronavirus OC43], codon optimized for human cell expression, NP_937950 |
CNY 20520.00 |
|
VC100602 | Myc-DDK-tagged ORF clone for NS2 protein [Human coronavirus OC43], codon optimized for human cell expression, NP_937951 |
CNY 3800.00 |
|
VC100603 | Myc-DDK-tagged ORF clone for NS3 protein [Human coronavirus OC43], codon optimized for human cell expression, NP_937952 |
CNY 3800.00 |
|
VC100604 | Myc-DDK-tagged ORF clone for M protein [Human coronavirus OC43], codon optimized for human cell expression, NP_937953 |
CNY 2400.00 |
|
VC100605 | Myc-DDK-tagged ORF clone for N protein [Human coronavirus OC43], codon optimized for human cell expression, NP_937954 |
CNY 5510.00 |