UL16 (NC_006273) Virus Tagged ORF Clone
CAT#: VC101207
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081475
View other clones from "Virus" (142)
Need custom modification / cloning service?
Get a free quote
CNY 3600.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Type | Virus Tagged ORF Clone |
| Tag | Myc-DDK |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>The Viral ORF clone VC101207 represents NCBI reference of YP_081475 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAACGCCGACGCGGTACAGTCCCTCTGGGATGGGTGTTTTTTGTACTGTGCCTCTCTGCCAGCTCAC CATGTGCCGTTGACCTGGGCAGCAAATCCAGTAACTCTACATGTCGCCTGAATGTCACCGAACTGGCCTC CATACACCCCGGAGAAACCTGGACGTTGCATGGAATGTGCATCTCAATTTGCTATTACGAAAATGTGACA GAGGACGAAATCATAGGCGTTGCTTTCACCTGGCAGCATAATGAATCCGTTGTAGACCTGTGGCTGTACC AAAATGACACAGTGATCCGAAATTTCAGCGACATCACTACTAACATCCTGCAAGATGGACTTAAGATGCG AACGGTCCCCGTCACCAAACTCTATACCTCCCGGATGGTCACTAATCTGACAGTTGGCAGGTACGACTGC CTCAGATGTGAGAACGGCACTATGAAAATCATTGAACGCCTGTACGTGCGGCTGGGCTCTCTGTACCCCC GGCCTCCAGGAAGTGGCTTGGCCAAACACCCGTCTGTGTCCGCCGACGAAGAGTTGAGCGCAACCCTCGC GAGAGATATCGTTCTTGTCTCTGCAATCACTCTCTTCTTTTTTCTGCTCGCACTCCGAATCCCACAGAGA CTGTGCCAGAGGCTGAGAATCCGGCTGCCACATAGGTACCAAAGGCTCCGGACAGAGGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101207 representing YP_081475
Red=Cloning sites Green=Tags MERRRGTVPLGWVFFVLCLSASSPCAVDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVT EDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDC LRCENGTMKIIERLYVRLGSLYPRPPGSGLAKHPSVSADEELSATLARDIVLVSAITLFFFLLALRIPQR LCQRLRIRLPHRYQRLRTED TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NC_006273 |
| ORF Size | 690 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NC_006273.2, YP_081475 |
| RefSeq ORF | 690 bp |
| Locus ID | 3077464 |
| MW | 26.2 kDa |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| VC101187 | Myc-DDK-tagged ORF clone of viral ORF for protein RL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081455 |
CNY 3800.00 |
|
| VC101188 | Myc-DDK-tagged ORF clone of viral ORF for protein RL5A [Human herpesvirus 5], codon optimized for human cell expression, YP_081456 |
CNY 3800.00 |
|
| VC101189 | Myc-DDK-tagged ORF clone of viral ORF for protein RL6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081457 |
CNY 3800.00 |
|
| VC101190 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein RL10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081458 |
CNY 3800.00 |
|
| VC101191 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein RL11 [Human herpesvirus 5], codon optimized for human cell expression, YP_081459 |
CNY 3800.00 |
|
| VC101192 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein RL12 [Human herpesvirus 5], codon optimized for human cell expression, YP_081460 |
CNY 5130.00 |
|
| VC101193 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein RL13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081461 |
CNY 3800.00 |
|
| VC101194 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081462 |
CNY 3800.00 |
|
| VC101195 | Myc-DDK-tagged ORF clone of viral ORF for protein UL2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081463 |
CNY 3800.00 |
|
| VC101196 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL4 [Human herpesvirus 5], codon optimized for human cell expression, YP_081464 |
CNY 3800.00 |
|
| VC101197 | Myc-DDK-tagged ORF clone of viral ORF for protein UL5 [Human herpesvirus 5], codon optimized for human cell expression, YP_081465 |
CNY 3800.00 |
|
| VC101198 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081466 |
CNY 3800.00 |
|
| VC101199 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081467 |
CNY 3800.00 |
|
| VC101200 | Myc-DDK-tagged ORF clone of viral ORF for protein UL8 [Human herpesvirus 5], codon optimized for human cell expression, YP_081468 |
CNY 3800.00 |
|
| VC101201 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL9 [Human herpesvirus 5], codon optimized for human cell expression, YP_081469 |
CNY 3800.00 |
|
| VC101202 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081470 |
CNY 3600.00 |
|
| VC101204 | Myc-DDK-tagged ORF clone of viral ORF for protein UL13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081472 |
CNY 5800.00 |
|
| VC101205 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081473 |
CNY 3800.00 |
|
| VC101206 | Myc-DDK-tagged ORF clone of viral ORF for protein UL15A [Human herpesvirus 5], codon optimized for human cell expression, YP_081474 |
CNY 3800.00 |
|
| VC101208 | Myc-DDK-tagged ORF clone of viral ORF for protein UL17 [Human herpesvirus 5], codon optimized for human cell expression, YP_081476 |
CNY 3800.00 |
|
| VC101209 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL18 [Human herpesvirus 5], codon optimized for human cell expression, YP_081477 |
CNY 4024.00 |
|
| VC101210 | Myc-DDK-tagged ORF clone of viral ORF for protein UL19 [Human herpesvirus 5], codon optimized for human cell expression, YP_081478 |
CNY 3800.00 |
|
| VC101211 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL20 [Human herpesvirus 5], codon optimized for human cell expression, YP_081479 |
CNY 4090.00 |
|
| VC101212 | Myc-DDK-tagged ORF clone of viral ORF for protein UL21A [Human herpesvirus 5], codon optimized for human cell expression, YP_081480 |
CNY 3800.00 |
|
| VC101213 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein UL22A [Human herpesvirus 5], codon optimized for human cell expression, YP_081481 |
CNY 3800.00 |
|
| VC101214 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL23 [Human herpesvirus 5], codon optimized for human cell expression, YP_081482 |
CNY 3800.00 |
|
| VC101215 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL24 [Human herpesvirus 5], codon optimized for human cell expression, YP_081483 |
CNY 3800.00 |
|
| VC101216 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL25 [Human herpesvirus 5], codon optimized for human cell expression, YP_081484 |
CNY 7890.00 |
|
| VC101217 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL26 [Human herpesvirus 5], codon optimized for human cell expression, YP_081485 |
CNY 3800.00 |
|
| VC101218 | Myc-DDK-tagged ORF clone of viral ORF for protein UL27 [Human herpesvirus 5], codon optimized for human cell expression, YP_081486 |
CNY 7320.00 |
|
| VC101219 | Myc-DDK-tagged ORF clone of viral ORF for protein UL29 [Human herpesvirus 5], codon optimized for human cell expression, YP_081487 |
CNY 10550.00 |
|
| VC101220 | Myc-DDK-tagged ORF clone of viral ORF for protein UL30 [Human herpesvirus 5], codon optimized for human cell expression, YP_081489 |
CNY 3800.00 |
|
| VC101221 | Myc-DDK-tagged ORF clone of viral ORF for protein UL31 [Human herpesvirus 5], codon optimized for human cell expression, YP_081490 |
CNY 7130.00 |
|
| VC101222 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp150 [Human herpesvirus 5], codon optimized for human cell expression, YP_081491 |
CNY 15870.00 |
|
| VC101223 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL33 [Human herpesvirus 5], codon optimized for human cell expression, YP_081492 |
CNY 4940.00 |
|
| VC101224 | Myc-DDK-tagged ORF clone of viral ORF for protein UL34 [Human herpesvirus 5], codon optimized for human cell expression, YP_081493 |
CNY 4940.00 |
|
| VC101225 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL35 [Human herpesvirus 5], codon optimized for human cell expression, YP_081494 |
CNY 7700.00 |
|
| VC101226 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein vICA [Human herpesvirus 5], codon optimized for human cell expression, YP_081495 |
CNY 5800.00 |
|
| VC101227 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL37 [Human herpesvirus 5], codon optimized for human cell expression, YP_081496 |
CNY 5990.00 |
|
| VC101228 | Myc-DDK-tagged ORF clone of viral ORF for protein UL38 [Human herpesvirus 5], codon optimized for human cell expression, YP_081497 |
CNY 3800.00 |
|
| VC101229 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL40 [Human herpesvirus 5], codon optimized for human cell expression, YP_081498 |
CNY 2640.00 |
|
| VC101230 | Myc-DDK-tagged ORF clone of viral ORF for protein UL41A [Human herpesvirus 5], codon optimized for human cell expression, YP_081499 |
CNY 3800.00 |
|
| VC101231 | Myc-DDK-tagged ORF clone of viral ORF for protein UL42 [Human herpesvirus 5], codon optimized for human cell expression, YP_081500 |
CNY 3800.00 |
|
| VC101232 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL43 [Human herpesvirus 5], codon optimized for human cell expression, YP_081501 |
CNY 5230.00 |
|
| VC101233 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081502 |
CNY 5320.00 |
|
| VC101234 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081503 |
CNY 13680.00 |
|
| VC101235 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081504 |
CNY 3800.00 |
|
| VC101236 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 5], codon optimized for human cell expression, YP_081505 |
CNY 14820.00 |
|
| VC101238 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081507 |
CNY 3800.00 |
|
| VC101239 | Myc-DDK-tagged ORF clone of viral ORF for protein UL49 [Human herpesvirus 5], codon optimized for human cell expression, YP_081508 |
CNY 6840.00 |
|
| VC101240 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081509 |
CNY 4750.00 |
|
| VC101241 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 5], codon optimized for human cell expression, YP_081510 |
CNY 3800.00 |
|
| VC101242 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 5], codon optimized for human cell expression, YP_081511 |
CNY 10070.00 |
|
| VC101243 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081512 |
CNY 4470.00 |
|
| VC101244 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081513 |
CNY 18810.00 |
|
| VC101245 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 5], codon optimized for human cell expression, YP_081514 |
CNY 13680.00 |
|
| VC101246 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081515 |
CNY 12920.00 |
|
| VC101248 | Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 5], codon optimized for human cell expression, YP_081517 |
CNY 11120.00 |
|
| VC101249 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 5], codon optimized for human cell expression, YP_081518 |
CNY 14250.00 |
|
| VC101250 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 5], codon optimized for human cell expression, YP_081519 |
CNY 4280.00 |
|
| VC101251 | Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 5], codon optimized for human cell expression, YP_081520 |
CNY 4660.00 |
|
| VC101252 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 5], codon optimized for human cell expression, YP_081521 |
CNY 3800.00 |
|
| VC101253 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein O [Human herpesvirus 5], codon optimized for human cell expression, YP_081522 |
CNY 5800.00 |
|
| VC101254 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein 24, partial [Human herpesvirus 5], codon optimized for human cell expression, YP_002802310 |
CNY 3800.00 |
|
| VC101255 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 5], codon optimized for human cell expression, YP_081523 |
CNY 11120.00 |
|
| VC101258 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL78 [Human herpesvirus 5], codon optimized for human cell expression, YP_081526 |
CNY 5320.00 |
|
| VC101259 | Myc-DDK-tagged ORF clone of viral ORF for protein UL79 [Human herpesvirus 5], codon optimized for human cell expression, YP_081527 |
CNY 3800.00 |
|
| VC101262 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp71 [Human herpesvirus 5], codon optimized for human cell expression, YP_081530 |
CNY 4160.00 |
|
| VC101263 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp65 [Human herpesvirus 5], codon optimized for human cell expression, YP_081531 |
CNY 4176.00 |
|
| VC101264 | Myc-DDK-tagged ORF clone of viral ORF for protein UL84 [Human herpesvirus 5], codon optimized for human cell expression, YP_081532 |
CNY 7030.00 |
|
| VC101265 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081533 |
CNY 3800.00 |
|
| VC101267 | Myc-DDK-tagged ORF clone of viral ORF for protein UL87 [Human herpesvirus 5], codon optimized for human cell expression, YP_081535 |
CNY 14160.00 |
|
| VC101268 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL88 [Human herpesvirus 5], codon optimized for human cell expression, YP_081536 |
CNY 5230.00 |
|
| VC101269 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081537 |
CNY 10170.00 |
|
| VC101270 | Myc-DDK-tagged ORF clone of viral ORF for protein UL91 [Human herpesvirus 5], codon optimized for human cell expression, YP_081538 |
CNY 3800.00 |
|
| VC101271 | Myc-DDK-tagged ORF clone of viral ORF for protein UL92 [Human herpesvirus 5], codon optimized for human cell expression, YP_081539 |
CNY 3800.00 |
|
| VC101273 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081541 |
CNY 4090.00 |
|
| VC101275 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081543 |
CNY 3800.00 |
|
| VC101276 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 5], codon optimized for human cell expression, YP_081544 |
CNY 10640.00 |
|
| VC101277 | Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 5], codon optimized for human cell expression, YP_081545 |
CNY 7030.00 |
|
| VC101278 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081546 |
CNY 3800.00 |
|
| VC101279 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 5], codon optimized for human cell expression, YP_081547 |
CNY 4470.00 |
|
| VC101281 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081549 |
CNY 3800.00 |
|
| VC101282 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081550 |
CNY 10550.00 |
|
| VC101284 | Myc-DDK-tagged ORF clone of viral ORF for interleukin-10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081552 |
CNY 3800.00 |
|
| VC101286 | Myc-DDK-tagged ORF clone of viral ORF for large tegument protein [Human herpesvirus 5], codon optimized for human cell expression, YP_081554 |
CNY 3800.00 |
|
| VC101287 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 5], codon optimized for human cell expression, YP_081555 |
CNY 3800.00 |
|
| VC101291 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL120 [Human herpesvirus 5], codon optimized for human cell expression, YP_081559 |
CNY 3800.00 |
|
| VC101292 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL121 [Human herpesvirus 5], codon optimized for human cell expression, YP_081560 |
CNY 3800.00 |
|
| VC101293 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081561 |
CNY 6480.00 |
|
| VC101294 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081562 |
CNY 4024.00 |
|
| VC101295 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL124 [Human herpesvirus 5], codon optimized for human cell expression, YP_081563 |
CNY 3800.00 |
|
| VC101296 | Myc-DDK-tagged ORF clone of viral ORF for truncated envelope protein UL128 [Human herpesvirus 5], codon optimized for human cell expression, YP_081564 |
CNY 3800.00 |
|
| VC101297 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL130 [Human herpesvirus 5], codon optimized for human cell expression, YP_081565 |
CNY 3800.00 |
|
| VC101298 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL131A [Human herpesvirus 5], codon optimized for human cell expression, YP_081566 |
CNY 3800.00 |
|
| VC101299 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL132 [Human herpesvirus 5], codon optimized for human cell expression, YP_081567 |
CNY 3800.00 |
|
| VC101300 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL148 [Human herpesvirus 5], codon optimized for human cell expression, YP_081568 |
CNY 3800.00 |
|
| VC101301 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL147A [Human herpesvirus 5], codon optimized for human cell expression, YP_081569 |
CNY 3800.00 |
|
| VC101302 | Myc-DDK-tagged ORF clone of viral ORF for chemokine vCXCL2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081570 |
CNY 3800.00 |
|
| VC101303 | Myc-DDK-tagged ORF clone of viral ORF for chemokine vCXCL1 [Human herpesvirus 5], codon optimized for human cell expression, YP_081571 |
CNY 3800.00 |
|
| VC101304 | Myc-DDK-tagged ORF clone of viral ORF for protein UL145 [Human herpesvirus 5], codon optimized for human cell expression, YP_081572 |
CNY 3800.00 |
|
| VC101305 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL144 [Human herpesvirus 5], codon optimized for human cell expression, YP_081573 |
CNY 3600.00 |
|
| VC101306 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL142 [Human herpesvirus 5], codon optimized for human cell expression, YP_081574 |
CNY 3600.00 |
|
| VC101307 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL141 [Human herpesvirus 5], codon optimized for human cell expression, YP_081575 |
CNY 3656.00 |
|
| VC101308 | Myc-DDK-tagged ORF clone of viral ORF for protein UL140 [Human herpesvirus 5], codon optimized for human cell expression, YP_081576 |
CNY 3800.00 |
|
| VC101309 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL139 [Human herpesvirus 5], codon optimized for human cell expression, YP_081577 |
CNY 3800.00 |
|
| VC101310 | Myc-DDK-tagged ORF clone of viral ORF for protein UL138 [Human herpesvirus 5], codon optimized for human cell expression, YP_081578 |
CNY 3600.00 |
|
| VC101312 | Myc-DDK-tagged ORF clone of viral ORF for protein UL135 [Human herpesvirus 5], codon optimized for human cell expression, YP_081580 |
CNY 3800.00 |
|
| VC101314 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148A [Human herpesvirus 5], codon optimized for human cell expression, YP_081582 |
CNY 3800.00 |
|
| VC101315 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148B [Human herpesvirus 5], codon optimized for human cell expression, YP_081583 |
CNY 3800.00 |
|
| VC101316 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148C [Human herpesvirus 5], codon optimized for human cell expression, YP_081584 |
CNY 3800.00 |
|
| VC101317 | Myc-DDK-tagged ORF clone of viral ORF for protein UL148D [Human herpesvirus 5], codon optimized for human cell expression, YP_081585 |
CNY 3800.00 |
|
| VC101318 | Myc-DDK-tagged ORF clone of viral ORF for protein UL150 [Human herpesvirus 5], codon optimized for human cell expression, YP_081586 |
CNY 7700.00 |
|
| VC101321 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US2 [Human herpesvirus 5], codon optimized for human cell expression, YP_081589 |
CNY 2640.00 |
|
| VC101322 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US3 [Human herpesvirus 5], codon optimized for human cell expression, YP_081590 |
CNY 3800.00 |
|
| VC101323 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US6 [Human herpesvirus 5], codon optimized for human cell expression, YP_081591 |
CNY 3800.00 |
|
| VC101324 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US7 [Human herpesvirus 5], codon optimized for human cell expression, YP_081592 |
CNY 3800.00 |
|
| VC101325 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US8 [Human herpesvirus 5], codon optimized for human cell expression, YP_081593 |
CNY 3800.00 |
|
| VC101326 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US9 [Human herpesvirus 5], codon optimized for human cell expression, YP_081594 |
CNY 3800.00 |
|
| VC101327 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US10 [Human herpesvirus 5], codon optimized for human cell expression, YP_081595 |
CNY 3800.00 |
|
| VC101328 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein US11 [Human herpesvirus 5], codon optimized for human cell expression, YP_081596 |
CNY 2400.00 |
|
| VC101329 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US12 [Human herpesvirus 5], codon optimized for human cell expression, YP_081597 |
CNY 3800.00 |
|
| VC101330 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US13 [Human herpesvirus 5], codon optimized for human cell expression, YP_081598 |
CNY 3800.00 |
|
| VC101331 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US14 [Human herpesvirus 5], codon optimized for human cell expression, YP_081599 |
CNY 3800.00 |
|
| VC101332 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US15 [Human herpesvirus 5], codon optimized for human cell expression, YP_081600 |
CNY 3800.00 |
|
| VC101333 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US16 [Human herpesvirus 5], codon optimized for human cell expression, YP_081601 |
CNY 3800.00 |
|
| VC101334 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US17 [Human herpesvirus 5], codon optimized for human cell expression, YP_081602 |
CNY 3800.00 |
|
| VC101335 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US18 [Human herpesvirus 5], codon optimized for human cell expression, YP_081603 |
CNY 3800.00 |
|
| VC101336 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US19 [Human herpesvirus 5], codon optimized for human cell expression, YP_081604 |
CNY 3800.00 |
|
| VC101337 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US20 [Human herpesvirus 5], codon optimized for human cell expression, YP_081605 |
CNY 3800.00 |
|
| VC101338 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US21 [Human herpesvirus 5], codon optimized for human cell expression, YP_081606 |
CNY 3800.00 |
|
| VC101339 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein US22 [Human herpesvirus 5], codon optimized for human cell expression, YP_081607 |
CNY 6940.00 |
|
| VC101340 | Myc-DDK-tagged ORF clone of viral ORF for protein US23 [Human herpesvirus 5], codon optimized for human cell expression, YP_081608 |
CNY 7130.00 |
|
| VC101342 | Myc-DDK-tagged ORF clone of viral ORF for protein US26 [Human herpesvirus 5], codon optimized for human cell expression, YP_081610 |
CNY 7220.00 |
|
| VC101343 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein US27 [Human herpesvirus 5], codon optimized for human cell expression, YP_081611 |
CNY 5488.00 |
|
| VC101344 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein US28 [Human herpesvirus 5], codon optimized for human cell expression, YP_081612 |
CNY 3656.00 |
|
| VC101345 | Myc-DDK-tagged ORF clone of viral ORF for protein US29 [Human herpesvirus 5], codon optimized for human cell expression, YP_081613 |
CNY 5610.00 |
|
| VC101346 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US30 [Human herpesvirus 5], codon optimized for human cell expression, YP_081614 |
CNY 4180.00 |
|
| VC101347 | Myc-DDK-tagged ORF clone of viral ORF for protein US31 [Human herpesvirus 5], codon optimized for human cell expression, YP_081615 |
CNY 3800.00 |
|
| VC101348 | Myc-DDK-tagged ORF clone of viral ORF for protein US32 [Human herpesvirus 5], codon optimized for human cell expression, YP_081616 |
CNY 3800.00 |
|
| VC101349 | Myc-DDK-tagged ORF clone of viral ORF for protein US34 [Human herpesvirus 5], codon optimized for human cell expression, YP_081617 |
CNY 3800.00 |
|
| VC101350 | Myc-DDK-tagged ORF clone of viral ORF for protein US34A [Human herpesvirus 5], codon optimized for human cell expression, YP_081618 |
CNY 3800.00 |

