U100 (NC_001664) Virus Tagged ORF Clone
CAT#: VC101437
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein Q [Human herpesvirus 6], codon optimized for human cell expression, NP_042993
View other clones from "Virus" (85)
Need custom modification / cloning service?
Get a free quote
CNY 7890.00
Product images

CNY 600.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101437 represents NCBI reference of NP_042993 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCACAGCCCGCTTGAGTGCTATGAAACCACCTCGCTCTTGTGCCCTGATCTTCCTGTGCGCATTCA GTATGGCTACAGCTCCAACTAATGCCACCGCTCACAGACGGGCGGGCACAGTGAAATCCACGCCACCTCC TGAAGACAAACATAGCTACACGGCAAAGTATTATGATAAGGATATCTATTTTAACATATACGAGGGACGG AACAGCACTCCTCGCCGCAGGACACTTTCAGAAATTATTAGTAAGTTTAGTACTAGCGAAATGCTTAGTC TGAAAAGAGTGAAGGCTTTCGTTCCCGTGGATGAGAACCCCACAACAACGCTCGAAGACATCGCGGATAT TCTGAACTACGCCGTTTGCGATGACAACAGTTGTGGCTGCACCATTGAGACGCAGGCCAGAATAATGTTT GGCGACATCATTATCTGTGTGCCACTCTCAGCCGACAATAAGGGCGTACGAAACTTCAAGGACCGGATAA TGCCGAAGGGCCTGAGTCAGATCCTCTCCTCTTCCCTTGGCCTGCACCTGAGTCTGCTGTACGGCGCCTT CGGGAGCAACTATAATAGCCTGGCCTATATGCGGAGACTGAAGCCTCTGACAGCTATGACAGCTATCCGC TTTTGTCCCATGACCACGAAACTGGAATTGAGACAAAATTACAAAGTCAAGGAGACGTTGTGTGAGCTGA TTGTGTCTATTGAGATCCTGAAAATCCGGAACAATGGAGGACAGACCATGAAGACTTTGACATCCTTTGC CATTGTCAGGAAAGATAATGACGGGCAGGACTGGGAAACCTGTACTCGGTTTGCCCCCGTAAACATCGAG GACATTCTTAGATATAAGAGGGTCGCCAATGACACCTGCTGTCGGCATCGCGATGTGCAGCATGGACGAA GGACACTGGAGAGTAGCAACAGTTGGACACAGACCCAGTATTTCGAGCCGTGGCAGGATATTGTTGACGT GTACGTGCCAATCAACGATACACACTGCCCCAACGATTCTTACGTGGTATTTGAGACTCTGCAGGGATTC GAGTGGTGCTCTCGACTTAATAAGAACGAGACGAAGAATTATCTCAGCTCTGTCCTGGGTTTCCGAAACG CACTGTTCGAGACGGAGGAACTCATGGAGACTATTGCCATGCGGCTTGCATCTCAGATCCTCAGCATGGT CGGTCAGCAGGGCACCACCATTAGGGACATCGACCCTGCCATAGTGTCAGCGTTGTGGCACAGTCTCCCG GAAAACCTTACCACGACTAACATAAAGTACGACATCGCAAGCCCCACACATATGAGGCCGGCTTTGTGCA CAATATTTGTTCAAACCGGAACATCAAAACAGAGATTTCGCAATGCTGGGCTGCTCATGGTGAACAATAT TTTCACAGTGCAGGGCCGCTACACGACCCAGAATATGTTTGAACGCAAGGAGTACGTCTATAAACATCTG GGTCAGGCACTTTGCCAGGACGGGGAGATCTTGTTTCAGAATGAAGGACAGAAGTTCTGTAGACCCCTGA CCGACAACAGGACTATCGTTTATACCATGCAGGATCAGGTACAGAAGCCGCTGAGCGTGACTTGGATGGA CTTTAACCTTGTGATTTCAGACTACGGAAGGGATGTAATCAACAACCTGACTAAGTCCGCAATGTTGGCA CGCAAAAACGGACCTCGGTATCTCCAGATGGAAAATGGTCCAAGATATCTTCAGATGGAAACCTTCATCA GCGATCTTTTTCGGCACGAGTGTTATCAGGACAATTATTATGTGCTGGACAAGAAGCTGCAGATGTTCTA CCCCACCACACATAGCAATGAACTGCTGTTCTACCCTTCAGAGGCGACGTTGCCCTCCCCATGGCAGGAG CCACCGTTCAGTTCCCCCTGGCCGGAGCCAACCTTCCCAAGCCGGTGGTATTGGCTTCTGCTGAACTACA CAAACTAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101437 representing NP_042993
Red=Cloning sites Green=Tags MATARLSAMKPPRSCALIFLCAFSMATAPTNATAHRRAGTVKSTPPPEDKHSYTAKYYDKDIYFNIYEGR NSTPRRRTLSEIISKFSTSEMLSLKRVKAFVPVDENPTTTLEDIADILNYAVCDDNSCGCTIETQARIMF GDIIICVPLSADNKGVRNFKDRIMPKGLSQILSSSLGLHLSLLYGAFGSNYNSLAYMRRLKPLTAMTAIR FCPMTTKLELRQNYKVKETLCELIVSIEILKIRNNGGQTMKTLTSFAIVRKDNDGQDWETCTRFAPVNIE DILRYKRVANDTCCRHRDVQHGRRTLESSNSWTQTQYFEPWQDIVDVYVPINDTHCPNDSYVVFETLQGF EWCSRLNKNETKNYLSSVLGFRNALFETEELMETIAMRLASQILSMVGQQGTTIRDIDPAIVSALWHSLP ENLTTTNIKYDIASPTHMRPALCTIFVQTGTSKQRFRNAGLLMVNNIFTVQGRYTTQNMFERKEYVYKHL GQALCQDGEILFQNEGQKFCRPLTDNRTIVYTMQDQVQKPLSVTWMDFNLVISDYGRDVINNLTKSAMLA RKNGPRYLQMENGPRYLQMETFISDLFRHECYQDNYYVLDKKLQMFYPTTHSNELLFYPSEATLPSPWQE PPFSSPWPEPTFPSRWYWLLLNYTNY TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001664 |
ORF Size | 1968 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_001664.2, NP_042993 |
RefSeq ORF | 1968 bp |
Locus ID | 1487972 |
MW | 75.6 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101352 | Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042883 |
CNY 10360.00 |
|
VC101353 | Myc-DDK-tagged ORF clone of viral ORF for protein DR6 [Human herpesvirus 6], codon optimized for human cell expression, NP_042888 |
CNY 4660.00 |
|
VC101354 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL23 [Human herpesvirus 6], codon optimized for human cell expression, NP_042893 |
CNY 4370.00 |
|
VC101355 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042894 |
CNY 4470.00 |
|
VC101356 | Myc-DDK-tagged ORF clone of viral ORF for protein UL27 [Human herpesvirus 6], codon optimized for human cell expression, NP_042895 |
CNY 6460.00 |
|
VC101357 | Myc-DDK-tagged ORF clone of viral ORF for protein UL28 [Human herpesvirus 6], codon optimized for human cell expression, NP_042898 |
CNY 18620.00 |
|
VC101358 | Myc-DDK-tagged ORF clone of viral ORF for protein UL31 [Human herpesvirus 6], codon optimized for human cell expression, NP_042901 |
CNY 5320.00 |
|
VC101359 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp150 [Human herpesvirus 6], codon optimized for human cell expression, NP_042902 |
CNY 13210.00 |
|
VC101360 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL33 [Human herpesvirus 6], codon optimized for human cell expression, NP_042903 |
CNY 4180.00 |
|
VC101361 | Myc-DDK-tagged ORF clone of viral ORF for protein U13 [Human herpesvirus 6], codon optimized for human cell expression, NP_042905 |
CNY 3800.00 |
|
VC101362 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL35 [Human herpesvirus 6], codon optimized for human cell expression, NP_042906 |
CNY 7320.00 |
|
VC101363 | Myc-DDK-tagged ORF clone of viral ORF for protein U15 [Human herpesvirus 6], codon optimized for human cell expression, NP_042907 |
CNY 3800.00 |
|
VC101364 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein vICA [Human herpesvirus 6], codon optimized for human cell expression, NP_042910 |
CNY 3990.00 |
|
VC101365 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein UL37 [Human herpesvirus 6], codon optimized for human cell expression, NP_042911 |
CNY 3800.00 |
|
VC101366 | Myc-DDK-tagged ORF clone of viral ORF for protein UL38 [Human herpesvirus 6], codon optimized for human cell expression, NP_042912 |
CNY 4660.00 |
|
VC101367 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein U20 [Human herpesvirus 6], codon optimized for human cell expression, NP_042913 |
CNY 5230.00 |
|
VC101368 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein U21 [Human herpesvirus 6], codon optimized for human cell expression, NP_042914 |
CNY 5320.00 |
|
VC101369 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein U22 [Human herpesvirus 6], codon optimized for human cell expression, NP_042915 |
CNY 3800.00 |
|
VC101370 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein U23 [Human herpesvirus 6], codon optimized for human cell expression, NP_042916 |
CNY 3800.00 |
|
VC101371 | Myc-DDK-tagged ORF clone of viral ORF for protein U24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042917 |
CNY 3800.00 |
|
VC101372 | Myc-DDK-tagged ORF clone of viral ORF for protein U24A [Human herpesvirus 6], codon optimized for human cell expression, YP_002608174 |
CNY 3800.00 |
|
VC101373 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL43 [Human herpesvirus 6], codon optimized for human cell expression, NP_042918 |
CNY 3800.00 |
|
VC101374 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL43 [Human herpesvirus 6], codon optimized for human cell expression, NP_042919 |
CNY 3800.00 |
|
VC101375 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042920 |
CNY 4370.00 |
|
VC101376 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042921 |
CNY 12260.00 |
|
VC101377 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042922 |
CNY 3800.00 |
|
VC101378 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 6], codon optimized for human cell expression, NP_042923 |
CNY 14060.00 |
|
VC101380 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042925 |
CNY 3800.00 |
|
VC101381 | Myc-DDK-tagged ORF clone of viral ORF for protein UL49 [Human herpesvirus 6], codon optimized for human cell expression, NP_042926 |
CNY 5700.00 |
|
VC101382 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042927 |
CNY 3800.00 |
|
VC101383 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 6], codon optimized for human cell expression, NP_042928 |
CNY 3800.00 |
|
VC101384 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 6], codon optimized for human cell expression, NP_042929 |
CNY 5890.00 |
|
VC101385 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042930 |
CNY 3800.00 |
|
VC101386 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042931 |
CNY 15390.00 |
|
VC101387 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 6], codon optimized for human cell expression, NP_042932 |
CNY 12640.00 |
|
VC101388 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 6], codon optimized for human cell expression, NP_042933 |
CNY 10930.00 |
|
VC101389 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042934 |
CNY 17100.00 |
|
VC101390 | Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 6], codon optimized for human cell expression, NP_042935 |
CNY 6270.00 |
|
VC101391 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042936 |
CNY 13020.00 |
|
VC101392 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 6], codon optimized for human cell expression, NP_042937 |
CNY 3800.00 |
|
VC101393 | Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 6], codon optimized for human cell expression, NP_042938 |
CNY 4470.00 |
|
VC101394 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 6], codon optimized for human cell expression, NP_042939 |
CNY 3800.00 |
|
VC101395 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein O [Human herpesvirus 6], codon optimized for human cell expression, NP_042940 |
CNY 7410.00 |
|
VC101396 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein 24 [Human herpesvirus 6], codon optimized for human cell expression, YP_002608175 |
CNY 3800.00 |
|
VC101397 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 6], codon optimized for human cell expression, NP_042941 |
CNY 10450.00 |
|
VC101398 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 6], codon optimized for human cell expression, NP_042942 |
CNY 3800.00 |
|
VC101399 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 6], codon optimized for human cell expression, NP_042943 |
CNY 6750.00 |
|
VC101400 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL78 [Human herpesvirus 6], codon optimized for human cell expression, NP_042944 |
CNY 3800.00 |
|
VC101401 | Myc-DDK-tagged ORF clone of viral ORF for protein UL79 [Human herpesvirus 6], codon optimized for human cell expression, NP_042945 |
CNY 3800.00 |
|
VC101402 | Myc-DDK-tagged ORF clone of viral ORF for capsid maturation protease [Human herpesvirus 6], codon optimized for human cell expression, NP_042946 |
CNY 6370.00 |
|
VC101403 | Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 6], codon optimized for human cell expression, YP_002608176 |
CNY 3800.00 |
|
VC101404 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein pp65 [Human herpesvirus 6], codon optimized for human cell expression, NP_042947 |
CNY 4024.00 |
|
VC101405 | Myc-DDK-tagged ORF clone of viral ORF for protein UL84 [Human herpesvirus 6], codon optimized for human cell expression, NP_042948 |
CNY 5320.00 |
|
VC101406 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 6], codon optimized for human cell expression, NP_042949 |
CNY 3800.00 |
|
VC101407 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042950 |
CNY 20330.00 |
|
VC101408 | Myc-DDK-tagged ORF clone of viral ORF for protein UL87 [Human herpesvirus 6], codon optimized for human cell expression, NP_042951 |
CNY 11690.00 |
|
VC101409 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL88 [Human herpesvirus 6], codon optimized for human cell expression, NP_042952 |
CNY 4180.00 |
|
VC101410 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042953 |
CNY 7980.00 |
|
VC101411 | Myc-DDK-tagged ORF clone of viral ORF for protein UL91 [Human herpesvirus 6], codon optimized for human cell expression, NP_042955 |
CNY 3800.00 |
|
VC101412 | Myc-DDK-tagged ORF clone of viral ORF for protein UL92 [Human herpesvirus 6], codon optimized for human cell expression, NP_042956 |
CNY 3800.00 |
|
VC101413 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL17 [Human herpesvirus 6], codon optimized for human cell expression, NP_042957 |
CNY 5420.00 |
|
VC101414 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 6], codon optimized for human cell expression, NP_042958 |
CNY 3990.00 |
|
VC101415 | Myc-DDK-tagged ORF clone of viral ORF for protein UL95 [Human herpesvirus 6], codon optimized for human cell expression, NP_042960 |
CNY 4180.00 |
|
VC101416 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 6], codon optimized for human cell expression, NP_042961 |
CNY 3800.00 |
|
VC101417 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 6], codon optimized for human cell expression, NP_042962 |
CNY 6750.00 |
|
VC101418 | Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 6], codon optimized for human cell expression, NP_042963 |
CNY 5990.00 |
|
VC101419 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042964 |
CNY 3800.00 |
|
VC101420 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 6], codon optimized for human cell expression, NP_042965 |
CNY 4090.00 |
|
VC101421 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 6], codon optimized for human cell expression, NP_042966 |
CNY 11880.00 |
|
VC101422 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042967 |
CNY 7890.00 |
|
VC101423 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 6], codon optimized for human cell expression, NP_042968 |
CNY 3800.00 |
|
VC101424 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 6], codon optimized for human cell expression, NP_042969 |
CNY 7790.00 |
|
VC101425 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 6], codon optimized for human cell expression, NP_042970 |
CNY 12540.00 |
|
VC101426 | Myc-DDK-tagged ORF clone of viral ORF for protein UL112 [Human herpesvirus 6], codon optimized for human cell expression, NP_042972 |
CNY 4024.00 |
|
VC101427 | Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 6], codon optimized for human cell expression, NP_042974 |
CNY 3800.00 |
|
VC101428 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 6], codon optimized for human cell expression, NP_042975 |
CNY 3800.00 |
|
VC101429 | Myc-DDK-tagged ORF clone of viral ORF for chemokine U83 [Human herpesvirus 6], codon optimized for human cell expression, NP_042976 |
CNY 3800.00 |
|
VC101430 | Myc-DDK-tagged ORF clone of viral ORF for protein UL117 [Human herpesvirus 6], codon optimized for human cell expression, NP_042977 |
CNY 4090.00 |
|
VC101431 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein UL119 [Human herpesvirus 6], codon optimized for human cell expression, NP_042978 |
CNY 3800.00 |
|
VC101433 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein IE1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042983 |
CNY 14160.00 |
|
VC101434 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL124 [Human herpesvirus 6], codon optimized for human cell expression, NP_042984 |
CNY 1320.00 |
|
VC101435 | Myc-DDK-tagged ORF clone of viral ORF for protein U94/rep [Human herpesvirus 6], codon optimized for human cell expression, NP_042987 |
CNY 5990.00 |
|
VC101436 | Myc-DDK-tagged ORF clone of viral ORF for protein U95 [Human herpesvirus 6], codon optimized for human cell expression, NP_042988 |
CNY 16910.00 |
|
VC101438 | Myc-DDK-tagged ORF clone of viral ORF for protein DR1 [Human herpesvirus 6], codon optimized for human cell expression, NP_042995 |
CNY 10360.00 |
|
VC101439 | Myc-DDK-tagged ORF clone of viral ORF for US22 family [Human herpesvirus 6], codon optimized for human cell expression, NP_043000 |
CNY 4660.00 |