K5 (NC_009333) Virus Tagged ORF Clone
CAT#: VC101645
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for K5 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129365
View other clones from "Virus" (82)
Need custom modification / cloning service?
Get a free quote
CNY 3800.00
Product images

CNY 600.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101645 represents NCBI reference of YP_001129365 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTAGCAAGGACGTGGAGGAAGGAGTGGAAGGACCTATATGCTGGATATGCCGCGAGGAAGTAGGAA ACGAGGGCATTCACCCTTGCGCTTGCACAGGTGAGCTGGACGTCGTCCATCCCCAGTGTCTCTCCACTTG GCTGACTGTCTCCCGCAATACAGCATGCCAGATGTGTAGAGTGATTTACAGAACGAGGACACAGTGGAGA AGCAGGTTGAACCTGTGGCCTGAGATGGAGCGGCAGGAGATCTTTGAGTTGTTCTTGCTGATGAGCGTGG TGGTGGCTGGGCTCGTAGGGGTCGCTTTGTGCACATGGACACTCCTGGTCATTCTGACTGCCCCTGCCGG AACTTTCAGCCCCGGGGCTGTCTTGGGCTTCCTCTGTTTCTTTGGCTTCTATCAGATCTTTATTGTGTTC GCCTTTGGCGGTATTTGTAGAGTATCTGGTACAGTAAGGGCACTCTACGCGGCCAACAACACGAGGGTGA CTGTCCTCCCTTACAGGAGGCCCCGCAGACCTACTGCTAACGAGGATAATATTGAGTTGACGGTGCTCGT CGGGCCTGCTGGAGGAACAGATGAGGAGCCTACCGATGAGTCTAGCGAGGGAGACGTCGCATCTGGTGAT AAGGAGCGCGACGGTTCCAGTGGCGATGAGCCGGACGGGGGGCCAAATGATAGAGCTGGCCTCAGAGGCA CAGCGCGGACAGATCTGTGCGCCCCAACAAAAAAACCTGTGCGGAAAAACCACCCGAAAAACAACGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101645 representing YP_001129365
Red=Cloning sites Green=Tags MASKDVEEGVEGPICWICREEVGNEGIHPCACTGELDVVHPQCLSTWLTVSRNTACQMCRVIYRTRTQWR SRLNLWPEMERQEIFELFLLMSVVVAGLVGVALCTWTLLVILTAPAGTFSPGAVLGFLCFFGFYQIFIVF AFGGICRVSGTVRALYAANNTRVTVLPYRRPRRPTANEDNIELTVLVGPAGGTDEEPTDESSEGDVASGD KERDGSSGDEPDGGPNDRAGLRGTARTDLCAPTKKPVRKNHPKNNG TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_009333 |
ORF Size | 768 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_009333.1, YP_001129365 |
RefSeq ORF | 768 bp |
Locus ID | 4961442 |
UniProt ID | Q2HR82 |
MW | 27.9 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101630 | Myc-DDK-tagged ORF clone of viral ORF for K1 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129350 |
CNY 3800.00 |
|
VC101631 | Myc-DDK-tagged ORF clone of viral ORF for KCP [Human herpesvirus 8], codon optimized for human cell expression, YP_001129351 |
CNY 6650.00 |
|
VC101632 | Myc-DDK-tagged ORF clone of viral ORF for ORF6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129352 |
CNY 17100.00 |
|
VC101633 | Myc-DDK-tagged ORF clone of viral ORF for ORF7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129353 |
CNY 10450.00 |
|
VC101634 | Myc-DDK-tagged ORF clone of viral ORF for ORF8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129354 |
CNY 12830.00 |
|
VC101635 | Myc-DDK-tagged ORF clone of viral ORF for ORF9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129355 |
CNY 15390.00 |
|
VC101636 | Myc-DDK-tagged ORF clone of viral ORF for ORF10 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129356 |
CNY 5130.00 |
|
VC101637 | Myc-DDK-tagged ORF clone of viral ORF for ORF11 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129357 |
CNY 4940.00 |
|
VC101638 | Myc-DDK-tagged ORF clone of viral ORF for K2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129358 |
CNY 3600.00 |
|
VC101639 | Myc-DDK-tagged ORF clone of viral ORF for ORF2 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129359 |
CNY 3800.00 |
|
VC101640 | Myc-DDK-tagged ORF clone of viral ORF for K3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129360 |
CNY 3800.00 |
|
VC101641 | Myc-DDK-tagged ORF clone of viral ORF for ORF70 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129361 |
CNY 3990.00 |
|
VC101642 | Myc-DDK-tagged ORF clone of viral ORF for K4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129362 |
CNY 3800.00 |
|
VC101643 | Myc-DDK-tagged ORF clone of viral ORF for K41 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129363 |
CNY 3800.00 |
|
VC101644 | Myc-DDK-tagged ORF clone of viral ORF for K42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129364 |
CNY 3800.00 |
|
VC101646 | Myc-DDK-tagged ORF clone of viral ORF for K6 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129366 |
CNY 3800.00 |
|
VC101647 | Myc-DDK-tagged ORF clone of viral ORF for K7 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129367 |
CNY 3800.00 |
|
VC101648 | Myc-DDK-tagged ORF clone of viral ORF for ORF16 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129368 |
CNY 3800.00 |
|
VC101649 | Myc-DDK-tagged ORF clone of viral ORF for ORF17 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129369 |
CNY 6460.00 |
|
VC101650 | Myc-DDK-tagged ORF clone of viral ORF for ORF175 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129370 |
CNY 3800.00 |
|
VC101651 | Myc-DDK-tagged ORF clone of viral ORF for ORF18 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129371 |
CNY 3800.00 |
|
VC101652 | Myc-DDK-tagged ORF clone of viral ORF for ORF19 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129372 |
CNY 6650.00 |
|
VC101653 | Myc-DDK-tagged ORF clone of viral ORF for ORF20 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129373 |
CNY 3800.00 |
|
VC101654 | Myc-DDK-tagged ORF clone of viral ORF for ORF21 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129374 |
CNY 7030.00 |
|
VC101655 | Myc-DDK-tagged ORF clone of viral ORF for ORF22 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129375 |
CNY 11020.00 |
|
VC101656 | Myc-DDK-tagged ORF clone of viral ORF for ORF23 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129376 |
CNY 4750.00 |
|
VC101657 | Myc-DDK-tagged ORF clone of viral ORF for ORF24 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129377 |
CNY 11310.00 |
|
VC101658 | Myc-DDK-tagged ORF clone of viral ORF for ORF25 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129378 |
CNY 20710.00 |
|
VC101659 | Myc-DDK-tagged ORF clone of viral ORF for ORF26 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129379 |
CNY 3800.00 |
|
VC101660 | Myc-DDK-tagged ORF clone of viral ORF for ORF27 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129380 |
CNY 3800.00 |
|
VC101661 | Myc-DDK-tagged ORF clone of viral ORF for ORF28 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129381 |
CNY 3800.00 |
|
VC101662 | Myc-DDK-tagged ORF clone of viral ORF for ORF29 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129382 |
CNY 10360.00 |
|
VC101663 | Myc-DDK-tagged ORF clone of viral ORF for ORF30 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129383 |
CNY 3800.00 |
|
VC101664 | Myc-DDK-tagged ORF clone of viral ORF for ORF31 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129384 |
CNY 3800.00 |
|
VC101665 | Myc-DDK-tagged ORF clone of viral ORF for ORF32 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129385 |
CNY 5510.00 |
|
VC101666 | Myc-DDK-tagged ORF clone of viral ORF for ORF33 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129386 |
CNY 3990.00 |
|
VC101667 | Myc-DDK-tagged ORF clone of viral ORF for ORF34 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129387 |
CNY 3800.00 |
|
VC101668 | Myc-DDK-tagged ORF clone of viral ORF for ORF35 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129388 |
CNY 3800.00 |
|
VC101669 | Myc-DDK-tagged ORF clone of viral ORF for ORF36 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129389 |
CNY 5420.00 |
|
VC101670 | Myc-DDK-tagged ORF clone of viral ORF for ORF37 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129390 |
CNY 5890.00 |
|
VC101671 | Myc-DDK-tagged ORF clone of viral ORF for ORF38 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129391 |
CNY 3800.00 |
|
VC101672 | Myc-DDK-tagged ORF clone of viral ORF for ORF39 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129392 |
CNY 4750.00 |
|
VC101673 | Myc-DDK-tagged ORF clone of viral ORF for ORF40 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129393 |
CNY 10070.00 |
|
VC101674 | Myc-DDK-tagged ORF clone of viral ORF for ORF42 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129394 |
CNY 3800.00 |
|
VC101675 | Myc-DDK-tagged ORF clone of viral ORF for ORF43 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129395 |
CNY 7320.00 |
|
VC101676 | Myc-DDK-tagged ORF clone of viral ORF for ORF44 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129396 |
CNY 11970.00 |
|
VC101677 | Myc-DDK-tagged ORF clone of viral ORF for ORF45 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129397 |
CNY 4940.00 |
|
VC101678 | Myc-DDK-tagged ORF clone of viral ORF for ORF46 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129398 |
CNY 3800.00 |
|
VC101679 | Myc-DDK-tagged ORF clone of viral ORF for ORF47 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129399 |
CNY 3800.00 |
|
VC101680 | Myc-DDK-tagged ORF clone of viral ORF for ORF48 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129400 |
CNY 4750.00 |
|
VC101681 | Myc-DDK-tagged ORF clone of viral ORF for ORF50 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129401 |
CNY 10450.00 |
|
VC101682 | Myc-DDK-tagged ORF clone of viral ORF for ORF49 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129402 |
CNY 3800.00 |
|
VC101683 | Myc-DDK-tagged ORF clone of viral ORF for K8 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129403 |
CNY 3800.00 |
|
VC101684 | Myc-DDK-tagged ORF clone of viral ORF for K81 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129404 |
CNY 3800.00 |
|
VC101685 | Myc-DDK-tagged ORF clone of viral ORF for ORF52 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129405 |
CNY 3800.00 |
|
VC101686 | Myc-DDK-tagged ORF clone of viral ORF for ORF53 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129406 |
CNY 3800.00 |
|
VC101687 | Myc-DDK-tagged ORF clone of viral ORF for ORF54 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129407 |
CNY 3800.00 |
|
VC101688 | Myc-DDK-tagged ORF clone of viral ORF for ORF55 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129408 |
CNY 3800.00 |
|
VC101689 | Myc-DDK-tagged ORF clone of viral ORF for ORF56 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129409 |
CNY 12730.00 |
|
VC101690 | Myc-DDK-tagged ORF clone of viral ORF for ORF57 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129410 |
CNY 5610.00 |
|
VC101691 | Myc-DDK-tagged ORF clone of viral ORF for K9 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129411 |
CNY 3656.00 |
|
VC101692 | Myc-DDK-tagged ORF clone of viral ORF for vIRF-4 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129412 |
CNY 13780.00 |
|
VC101693 | Myc-DDK-tagged ORF clone of viral ORF for vIRF-3 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129413 |
CNY 6840.00 |
|
VC101695 | Myc-DDK-tagged ORF clone of viral ORF for ORF58 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129415 |
CNY 4280.00 |
|
VC101696 | Myc-DDK-tagged ORF clone of viral ORF for ORF59 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129416 |
CNY 4750.00 |
|
VC101697 | Myc-DDK-tagged ORF clone of viral ORF for ORF60 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129417 |
CNY 3800.00 |
|
VC101698 | Myc-DDK-tagged ORF clone of viral ORF for ORF61 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129418 |
CNY 12070.00 |
|
VC101699 | Myc-DDK-tagged ORF clone of viral ORF for ORF62 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129419 |
CNY 3800.00 |
|
VC101700 | Myc-DDK-tagged ORF clone of viral ORF for ORF63 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129420 |
CNY 13970.00 |
|
VC101702 | Myc-DDK-tagged ORF clone of viral ORF for ORF65 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129422 |
CNY 3800.00 |
|
VC101703 | Myc-DDK-tagged ORF clone of viral ORF for ORF66 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129423 |
CNY 5230.00 |
|
VC101704 | Myc-DDK-tagged ORF clone of viral ORF for ORF67 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129424 |
CNY 3800.00 |
|
VC101705 | Myc-DDK-tagged ORF clone of viral ORF for ORF67A [Human herpesvirus 8], codon optimized for human cell expression, YP_001129425 |
CNY 3800.00 |
|
VC101706 | Myc-DDK-tagged ORF clone of viral ORF for ORF68 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129426 |
CNY 5700.00 |
|
VC101707 | Myc-DDK-tagged ORF clone of viral ORF for ORF69 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129427 |
CNY 3800.00 |
|
VC101708 | Myc-DDK-tagged ORF clone of viral ORF for K12 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129428 |
CNY 3800.00 |
|
VC101709 | Myc-DDK-tagged ORF clone of viral ORF for K13 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129429 |
CNY 3800.00 |
|
VC101710 | Myc-DDK-tagged ORF clone of viral ORF for ORF72 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129430 |
CNY 3800.00 |
|
VC101712 | Myc-DDK-tagged ORF clone of viral ORF for K14 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129432 |
CNY 3800.00 |
|
VC101713 | Myc-DDK-tagged ORF clone of viral ORF for ORF74 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129433 |
CNY 5488.00 |
|
VC101714 | Myc-DDK-tagged ORF clone of viral ORF for ORF75 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129434 |
CNY 19570.00 |
|
VC101715 | Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 8], codon optimized for human cell expression, YP_001129435 |
CNY 5990.00 |