1A VP4b mature peptide (alt.) (NC_001489) Virus Tagged ORF Clone
CAT＃: VC102181
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for 1A VP4b mature peptide (alt) [Hepatitis A virus], codon optimized for human cell expression, NP_740549
View other clones from "Virus" (10)
Need custom modification / cloning service?
Get a free quote
CNY 3800.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Type | Virus Tagged ORF Clone |
| Tag | Myc-DDK |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>VC102181 representing NP_740549.
Blue=ORF Red=Cloning site Green=Tag(s) GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC ATGATGTCCCGCCAGGGGATCTTTCAGACTGTAGGTAGCGGGCTGGATCATATACTCTCACTCGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC >VC102181 representing NP_740549
Blue=ORF Red=Cloning site Green=Tag(s) MMSRQGIFQTVGSGLDHILSLA myc-FLAG tag |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NC_001489 |
| ORF Size | 66 bp |
| OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NP_740549 |
| RefSeq ORF | 66 bp |
| MW | 2.4 kDa |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| VC102180 | Myc-DDK-tagged ORF clone of viral ORF for 1A VP4a mature peptide (alt) [Hepatitis A virus], codon optimized for human cell expression, NP_740548 |
CNY 3800.00 |
|
| VC102182 | Myc-DDK-tagged ORF clone of viral ORF for 1B VP2 mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740550 |
CNY 3800.00 |
|
| VC102183 | Myc-DDK-tagged ORF clone of viral ORF for 1C VP3 mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740551 |
CNY 3840.00 |
|
| VC102184 | Myc-DDK-tagged ORF clone of viral ORF for 1D VP1 mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740552 |
CNY 3840.00 |
|
| VC102185 | Myc-DDK-tagged ORF clone of viral ORF for 2A mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740553 |
CNY 3800.00 |
|
| VC102186 | Myc-DDK-tagged ORF clone of viral ORF for 2B mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740554 |
CNY 3800.00 |
|
| VC102187 | Myc-DDK-tagged ORF clone of viral ORF for 2C mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740555 |
CNY 3990.00 |
|
| VC102188 | Myc-DDK-tagged ORF clone of viral ORF for 3A mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740556 |
CNY 3800.00 |
|
| VC102189 | Myc-DDK-tagged ORF clone of viral ORF for 3B (VPg) mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740557 |
CNY 3800.00 |
|
| VC102190 | Myc-DDK-tagged ORF clone of viral ORF for 3C mature peptide [Hepatitis A virus], codon optimized for human cell expression, NP_740558 |
CNY 3800.00 |
其它1A VP4b mature peptide (alt.)产品
