NF2 (NM_000268) Human Mutant ORF Clone

CAT#: RC401914

  • TrueORF®

NF2 Mutant (E38X), Myc-DDK-tagged ORF clone of Homo sapiens neurofibromin 2 (merlin) (NF2), transcript variant 1 as transfection-ready DNA



Need custom modification / cloning service?
Get a free quote

CNY 3990.00


货期*
3周

规格
    • 10 ug

Product images

Specifications

Product Data
Product Name NF2 (NM_000268) Human Mutant ORF Clone
Mutation Description E38X
Affected Codon# 38
Affected NT# 112
Nucleotide Mutation NF2 Mutant (E38X), Myc-DDK-tagged ORF clone of Homo sapiens neurofibromin 2 (merlin) (NF2), transcript variant 1 as transfection-ready DNA
Effect Neurofibromosis 2
Synonyms ACN; BANF; merlin-1; SCH
Vector pCMV6-Entry
Tag Myc-DDK
ACCN NM_000268
ORF Size 111 bp
Sequence Data
>RC401914 representing NM_000268
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCG
TGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAATTGC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC401914 representing NM_000268
Red=Cloning site Green=Tags(s)

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNC

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NP_000259
RefSeq Size 111 bp
RefSeq ORF 1788 bp
Locus ID 4771
Domains B41, ERM
Protein Families Druggable Genome
MW 4.1 kDa
Gene Summary This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...