PPIL1 (NM_016059) Human Mass Spec Standard
CAT#: PH300015
PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143)
View other "PPIL1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200015 |
Predicted MW | 18.2 kDa |
Protein Sequence |
>RC200015 protein sequence
Red=Cloning site Green=Tags(s) MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVN RVGMVETNSQDRPVDDVKIIKAYPSG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057143 |
RefSeq Size | 1750 |
RefSeq ORF | 498 |
Synonyms | CGI-124; CYPL1; hCyPX; PCH14; PPIase |
Locus ID | 51645 |
Cytogenetics | 6p21.2 |
Summary | This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq, Jul 2008] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414224 | PPIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414224 | Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) |
CNY 3080.00 |
|
TP300015 | Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1), 20 µg |
CNY 2900.00 |
|
TP720261 | Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) |
CNY 1800.00 |