MRPS7 (NM_015971) Human Mass Spec Standard
CAT#: PH300031
MRPS7 MS Standard C13 and N15-labeled recombinant protein (NP_057055)
View other "MRPS7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | MRPS7 MS Standard C13 and N15-labeled recombinant protein (NP_057055) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200031 |
Predicted MW | 28.2 kDa |
Protein Sequence |
>RC200031 protein sequence
Red=Cloning site Green=Tags(s) MVAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKK TQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN PYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLL EAFHNQGPVIKRKHDLHKMAEANRALAHYRWW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057055 |
RefSeq Size | 1432 |
RefSeq ORF | 726 |
Synonyms | bMRP27a; COXPD34; MRP-S; MRP-S7; RP-S7; RPMS7; S7mt |
Locus ID | 51081 |
Cytogenetics | 17q25.1 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414276 | MRPS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414276 | Transient overexpression lysate of mitochondrial ribosomal protein S7 (MRPS7), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP300031 | Recombinant protein of human mitochondrial ribosomal protein S7 (MRPS7), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |