EXOSC3 (NM_016042) Human Mass Spec Standard
CAT＃: PH300035
EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_057126)
View other "EXOSC3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_057126) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200035 |
| Predicted MW | 29.6 kDa |
| Protein Sequence |
>RC200035 protein sequence
Red=Cloning site Green=Tags(s) MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS LSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKL LAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057126 |
| RefSeq Size | 1857 |
| RefSeq ORF | 825 |
| Synonyms | bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p |
| Locus ID | 51010 |
| Cytogenetics | 9p13.2 |
| Summary | This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | RNA degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414229 | EXOSC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424199 | EXOSC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414229 | Transient overexpression lysate of exosome component 3 (EXOSC3), transcript variant 1 |
CNY 3080.00 |
|
| LY424199 | Transient overexpression lysate of exosome component 3 (EXOSC3), transcript variant 2 |
CNY 3080.00 |
|
| PH318361 | EXOSC3 MS Standard C13 and N15-labeled recombinant protein (NP_001002269) |
CNY 14250.00 |
|
| TP300035 | Recombinant protein of human exosome component 3 (EXOSC3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP318361 | Purified recombinant protein of Homo sapiens exosome component 3 (EXOSC3), transcript variant 2, 20 µg |
CNY 2900.00 |
