Glutathione S Transferase theta 2 (GSTT2) (NM_000854) Human Mass Spec Standard
CAT#: PH300040
GSTT2 MS Standard C13 and N15-labeled recombinant protein (NP_000845)
View other "Glutathione S Transferase theta 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | GSTT2 MS Standard C13 and N15-labeled recombinant protein (NP_000845) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200040 |
Predicted MW | 27.5 kDa |
Protein Sequence |
>RC200040 protein sequence
Red=Cloning site Green=Tags(s) MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAI LIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMD QALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAH SIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000845 |
RefSeq Size | 1136 |
RefSeq ORF | 732 |
Locus ID | 2953 |
Cytogenetics | 22q11.23 |
Summary | The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1, GSTT2, and GSTT2B. GSTT2 and GSTT2B are nearly identical to each other, and share 55% amino acid identity with GSTT1. All three genes may play a role in human carcinogenesis. The GSTT2 gene is a pseudogene in some populations. [provided by RefSeq, Sep 2015] |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424485 | GSTT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424485 | Transient overexpression lysate of glutathione S-transferase theta 2 (GSTT2) |
CNY 3080.00 |
|
TP300040 | Recombinant protein of human glutathione S-transferase theta 2 (GSTT2), 20 µg |
CNY 2900.00 |
其它Glutathione S Transferase theta 2产品