Apc11 (ANAPC11) (NM_001002244) Human Mass Spec Standard
CAT＃: PH300097
ANAPC11 MS Standard C13 and N15-labeled recombinant protein (NP_001002244)
View other "Apc11" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ANAPC11 MS Standard C13 and N15-labeled recombinant protein (NP_001002244) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200097 |
| Predicted MW | 20.6 kDa |
| Protein Sequence |
>RC200097 protein sequence
Red=Cloning site Green=Tags(s) MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCPLHGESISRCLGWCPQPVPVLGGRAHPQVPINT ASPTPGQHTGSLMSREESSRSPDPTPPALDQETSSLLRCTSPWCLDHSCDLFGITDQVSADGPRACRQGA RRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGVRPDLALAGGAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001002244 |
| RefSeq Size | 1186 |
| RefSeq ORF | 588 |
| Synonyms | APC11; Apc11p; HSPC214 |
| Locus ID | 51529 |
| Cytogenetics | 17q25.3 |
| Summary | Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413973 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424181 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424182 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424183 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424184 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424185 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424186 | ANAPC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413973 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 2 |
CNY 3080.00 |
|
| LY424181 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1 |
CNY 3080.00 |
|
| LY424182 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 3 |
CNY 3080.00 |
|
| LY424183 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 4 |
CNY 3080.00 |
|
| LY424184 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 5 |
CNY 3080.00 |
|
| LY424185 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 6 |
CNY 3080.00 |
|
| LY424186 | Transient overexpression lysate of anaphase promoting complex subunit 11 (ANAPC11), transcript variant 7 |
CNY 3080.00 |
|
| TP300097 | Recombinant protein of human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760669 | Purified recombinant protein of Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
