COX16 (NM_016468) Human Mass Spec Standard
CAT#: PH300099
COX16 MS Standard C13 and N15-labeled recombinant protein (NP_057552)
View other "COX16" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | COX16 MS Standard C13 and N15-labeled recombinant protein (NP_057552) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200099 |
| Predicted MW | 12.3 kDa |
| Protein Sequence |
>RC200099 protein sequence
Red=Cloning site Green=Tags(s) MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057552 |
| RefSeq Size | 1724 |
| RefSeq ORF | 318 |
| Synonyms | C14orf112; hCOX16; HSPC203 |
| Locus ID | 51241 |
| Cytogenetics | 14q24.2 |
| Summary | Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase (PubMed:29355485, PubMed:29381136). Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2) (PubMed:29355485, PubMed:29381136). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6 (PubMed:29381136). Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines (PubMed:29381136).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413968 | COX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413968 | Transient overexpression lysate of COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16) |
CNY 3080.00 |
|
| TP300099 | Recombinant protein of human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16), 20 µg |
CNY 2900.00 |
