TOLLIP (NM_019009) Human Mass Spec Standard
CAT#: PH300227
TOLLIP MS Standard C13 and N15-labeled recombinant protein (NP_061882)
View other "TOLLIP" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TOLLIP MS Standard C13 and N15-labeled recombinant protein (NP_061882) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200227 |
| Predicted MW | 30.3 kDa |
| Protein Sequence |
>RC200227 protein sequence
Red=Cloning site Green=Tags(s) MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061882 |
| RefSeq Size | 3665 |
| RefSeq ORF | 822 |
| Synonyms | IL-1RAcPIP |
| Locus ID | 54472 |
| Cytogenetics | 11p15.5 |
| Summary | This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover of IL1R-associated kinase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome |
| Protein Pathways | Toll-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402724 | TOLLIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402724 | Transient overexpression lysate of toll interacting protein (TOLLIP) |
CNY 3080.00 |
|
| TP300227 | Recombinant protein of human toll interacting protein (TOLLIP), 20 µg |
CNY 2900.00 |
|
| TP720557 | Recombinant protein of human toll interacting protein (TOLLIP) |
CNY 1800.00 |
