Sumo 3 (SUMO3) (NM_006936) Human Mass Spec Standard
CAT#: PH300241
SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867)
View other "Sumo 3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200241 |
| Predicted MW | 11.6 kDa |
| Protein Sequence |
>RC200241 protein sequence
Red=Cloning site Green=Tags(s) MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008867 |
| RefSeq Size | 1831 |
| RefSeq ORF | 309 |
| Synonyms | SMT3A; Smt3B; SMT3H1; SUMO-3 |
| Locus ID | 6612 |
| Cytogenetics | 21q22.3 |
| Summary | This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402068 | SUMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402068 | Transient overexpression lysate of SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
CNY 3080.00 |
|
| TP300241 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), 20 µg |
CNY 2900.00 |
|
| TP720508 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
CNY 1800.00 |
|
| TP721152 | Purified recombinant protein of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
CNY 1800.00 |
