HRASLS3 (PLA2G16) (NM_007069) Human Mass Spec Standard
CAT#: PH300242
PLA2G16 MS Standard C13 and N15-labeled recombinant protein (NP_009000)
View other "HRASLS3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PLA2G16 MS Standard C13 and N15-labeled recombinant protein (NP_009000) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200242 |
| Predicted MW | 17.9 kDa |
| Protein Sequence |
>RC200242 representing NM_007069
Red=Cloning site Green=Tags(s) MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA GMGLAAMSLIGVMFSRNKRQKQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009000 |
| RefSeq Size | 1070 |
| RefSeq ORF | 486 |
| Synonyms | AdPLA; H-REV107; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3; PLA2G16; PLAAT-3 |
| Locus ID | 11145 |
| Cytogenetics | 11q12.3-q13.1 |
| Summary | Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:22923616). For most substrates, PLA1 activity is much higher than PLA2 activity (PubMed:19615464). Shows O-acyltransferase activity,catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid (PubMed:19615464). Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381). Exhibits high N-acyltransferase activity and low phospholipase A1/2 activity (PubMed:22825852).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416202 | PLA2G16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426918 | PLA2G16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416202 | Transient overexpression lysate of phospholipase A2, group XVI (PLA2G16), transcript variant 1 |
CNY 3080.00 |
|
| LY426918 | Transient overexpression lysate of phospholipase A2, group XVI (PLA2G16), transcript variant 2 |
CNY 3080.00 |
|
| PH325152 | PLA2G16 MS Standard C13 and N15-labeled recombinant protein (NP_001121675) |
CNY 19520.00 |
|
| TP300242 | Recombinant protein of human phospholipase A2, group XVI (PLA2G16), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325152 | Recombinant protein of human phospholipase A2, group XVI (PLA2G16), transcript variant 2, 20 µg |
CNY 2900.00 |
其它HRASLS3产品
