AKR1A1 (NM_006066) Human Mass Spec Standard
CAT#: PH300302
AKR1A1 MS Standard C13 and N15-labeled recombinant protein (NP_006057)
View other "AKR1A1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | AKR1A1 MS Standard C13 and N15-labeled recombinant protein (NP_006057) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200302 |
| Predicted MW | 36.6 kDa |
| Protein Sequence |
>RC200302 protein sequence
Red=Cloning site Green=Tags(s) MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006057 |
| RefSeq Size | 1597 |
| RefSeq ORF | 975 |
| Synonyms | ALDR1; ALR; ARM; DD3; HEL-S-6 |
| Locus ID | 10327 |
| Cytogenetics | 1p34.1 |
| Summary | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein. [provided by RefSeq, Jan 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401826 | AKR1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407047 | AKR1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401826 | Transient overexpression lysate of aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1 |
CNY 3080.00 |
|
| LY407047 | Transient overexpression lysate of aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 2 |
CNY 3080.00 |
|
| PH302813 | AKR1A1 MS Standard C13 and N15-labeled recombinant protein (NP_697021) |
CNY 19520.00 |
|
| TP300302 | Recombinant protein of human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP302813 | Recombinant protein of human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 2, 20 µg |
CNY 2900.00 |
