GPR56 (ADGRG1) (NM_005682) Human Mass Spec Standard
CAT#: PH300315
GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_005673)
View other "GPR56" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_005673) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200315 |
| Predicted MW | 77.7 kDa |
| Protein Sequence |
>RC200315 protein sequence
Red=Cloning site Green=Tags(s) MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAP FPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSV TSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQ SLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGR SGEAEKRLLLVDFSSQALFQDKNSSHVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWV EDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV TIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCL SWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPS MCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSF ASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005673 |
| RefSeq Size | 3831 |
| RefSeq ORF | 2079 |
| Synonyms | BFPP; BPPR; GPR56; TM7LN4; TM7XN1 |
| Locus ID | 9289 |
| Cytogenetics | 16q21 |
| Summary | This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401733 | ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404437 | ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428998 | ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401733 | Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 1 |
CNY 3080.00 |
|
| LY404437 | Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 2 |
CNY 4840.00 |
|
| LY428998 | Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 4 |
CNY 4840.00 |
|
| PH318780 | GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_958932) |
CNY 19520.00 |
|
| PH326861 | GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_001139243) |
CNY 19520.00 |
|
| TP300315 | Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP318780 | Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326861 | Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 4, 20 µg |
CNY 2900.00 |
