UXT (NM_004182) Human Mass Spec Standard
CAT#: PH300343
UXT MS Standard C13 and N15-labeled recombinant protein (NP_004173)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UXT MS Standard C13 and N15-labeled recombinant protein (NP_004173) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200343 |
| Predicted MW | 18.2 kDa |
| Protein Sequence |
>RC200343 protein sequence
Red=Cloning site Green=Tags(s) MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQ VDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE GLRELQGLQNFPEKPHH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004173 |
| RefSeq Size | 619 |
| RefSeq ORF | 471 |
| Synonyms | ART-27; STAP1 |
| Locus ID | 8409 |
| Cytogenetics | Xp11.23 |
| Summary | The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418160 | UXT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418160 | Transient overexpression lysate of ubiquitously-expressed transcript (UXT), transcript variant 2 |
CNY 3080.00 |
|
| TP300343 | Recombinant protein of human ubiquitously-expressed transcript (UXT), transcript variant 2, 20 µg |
CNY 2900.00 |
