Neuraminidase (NEU1) (NM_000434) Human Mass Spec Standard
CAT#: PH300386
NEU1 MS Standard C13 and N15-labeled recombinant protein (NP_000425)
View other "Neuraminidase" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | NEU1 MS Standard C13 and N15-labeled recombinant protein (NP_000425) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200386 |
| Predicted MW | 45.5 kDa |
| Protein Sequence |
>RC200386 protein sequence
Red=Cloning site Green=Tags(s) MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQ IGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLG AVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREP RKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINAR NQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSF SNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000425 |
| RefSeq Size | 2088 |
| RefSeq ORF | 1245 |
| Synonyms | NANH; NEU; SIAL1 |
| Locus ID | 4758 |
| Cytogenetics | 6p21.33 |
| Summary | The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Lysosome, Other glycan degradation, Sphingolipid metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424720 | NEU1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424720 | Transient overexpression lysate of sialidase 1 (lysosomal sialidase) (NEU1) |
CNY 3080.00 |
|
| TP300386 | Recombinant protein of human sialidase 1 (lysosomal sialidase) (NEU1), 20 µg |
CNY 2900.00 |
|
| TP721041 | Purified recombinant protein of Human sialidase 1 (lysosomal sialidase) (NEU1) |
CNY 1800.00 |
其它Neuraminidase产品
