Ezrin (EZR) (NM_003379) Human Mass Spec Standard
CAT#: PH300404
EZR MS Standard C13 and N15-labeled recombinant protein (NP_003370)
View other "Ezrin" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | EZR MS Standard C13 and N15-labeled recombinant protein (NP_003370) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200404 |
| Predicted MW | 69.4 kDa |
| Protein Sequence |
>RC200404 protein sequence
Red=Cloning site Green=Tags(s) MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEV RKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKE VHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKN KKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQ DEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQ GRDKYKTLRQIRQGNTKQRIDEFEAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003370 |
| RefSeq Size | 3172 |
| RefSeq ORF | 1758 |
| Synonyms | CVIL; CVL; HEL-S-105; VIL2 |
| Locus ID | 7430 |
| Cytogenetics | 6q25.3 |
| Summary | The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401164 | EZR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426350 | EZR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401164 | Transient overexpression lysate of ezrin (EZR), transcript variant 1 |
CNY 3080.00 |
|
| LY426350 | Transient overexpression lysate of ezrin (EZR), transcript variant 2 |
CNY 3080.00 |
|
| PH325989 | EZR MS Standard C13 and N15-labeled recombinant protein (NP_001104547) |
CNY 19520.00 |
|
| TP300404 | Recombinant protein of human ezrin (EZR), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325989 | Recombinant protein of human ezrin (EZR), transcript variant 2, 20 µg |
CNY 2900.00 |
