RAB7L1 (RAB29) (NM_003929) Human Mass Spec Standard
CAT＃: PH300431
RAB7L1 MS Standard C13 and N15-labeled recombinant protein (NP_003920)
View other "RAB7L1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | RAB7L1 MS Standard C13 and N15-labeled recombinant protein (NP_003920) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200431 |
| Predicted MW | 23.2 kDa |
| Protein Sequence |
>RC200431 protein sequence
Red=Cloning site Green=Tags(s) MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERF TSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQID RFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003920 |
| RefSeq Size | 3324 |
| RefSeq ORF | 609 |
| Synonyms | RAB7L; RAB7L1 |
| Locus ID | 8934 |
| Cytogenetics | 1q32.1 |
| Summary | Rab GTPase key regulator in vesicle trafficking. Essential for maintaining the integrity of the endosome-trans-Golgi network structure. Together with LRRK2, plays a role in the retrograde trafficking pathway for recycling proteins, such as mannose 6 phosphate receptor (M6PR), between lysosomes and the Golgi apparatus in a retromer-dependent manner. Regulates neuronal process morphology in the intact central nervous system (CNS). May play a role in the formation of typhoid toxin transport intermediates during Salmonella enterica serovar Typhi (S.Typhi) epithelial cell infection.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418334 | RAB29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427656 | RAB29 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418334 | Transient overexpression lysate of RAB7, member RAS oncogene family-like 1 (RAB7L1), transcript variant 1 |
CNY 3080.00 |
|
| LY427656 | Transient overexpression lysate of RAB7, member RAS oncogene family-like 1 (RAB7L1), transcript variant 2 |
CNY 3080.00 |
|
| PH327093 | RAB7L1 MS Standard C13 and N15-labeled recombinant protein (NP_001129134) |
CNY 19520.00 |
|
| TP300431 | Recombinant protein of human RAB7, member RAS oncogene family-like 1 (RAB7L1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP327093 | Recombinant protein of human RAB7, member RAS oncogene family-like 1 (RAB7L1), transcript variant 2, 20 µg |
CNY 2900.00 |
