PTP4A1 (NM_003463) Human Mass Spec Standard
CAT#: PH300435
PTP4A1 MS Standard C13 and N15-labeled recombinant protein (NP_003454)
View other "PTP4A1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PTP4A1 MS Standard C13 and N15-labeled recombinant protein (NP_003454) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200435 |
| Predicted MW | 19.8 kDa |
| Protein Sequence |
>RC200435 protein sequence
Red=Cloning site Green=Tags(s) MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGA FNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003454 |
| RefSeq Size | 5093 |
| RefSeq ORF | 519 |
| Synonyms | HH72; PRL-1; PRL1; PTP(CAAX1); PTPCAAX1 |
| Locus ID | 7803 |
| Cytogenetics | 6q12 |
| Summary | This gene encodes a member of a small class of prenylated protein tyrosine phosphatases (PTPs), which contain a PTP domain and a characteristic C-terminal prenylation motif. The encoded protein is a cell signaling molecule that plays regulatory roles in a variety of cellular processes, including cell proliferation and migration. The protein may also be involved in cancer development and metastasis. This tyrosine phosphatase is a nuclear protein, but may associate with plasma membrane by means of its prenylation motif. Pseudogenes related to this gene are located on chromosomes 1, 2, 5, 7, 11 and X. [provided by RefSeq, Jun 2013] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418665 | PTP4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418665 | Transient overexpression lysate of protein tyrosine phosphatase type IVA, member 1 (PTP4A1) |
CNY 3080.00 |
|
| TP300435 | Recombinant protein of human protein tyrosine phosphatase type IVA, member 1 (PTP4A1), 20 µg |
CNY 2900.00 |
