PRMT2 (NM_206962) Human Mass Spec Standard
CAT#: PH300461
PRMT2 MS Standard C13 and N15-labeled recombinant protein (NP_996845)
View other "PRMT2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | PRMT2 MS Standard C13 and N15-labeled recombinant protein (NP_996845) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200461 |
Predicted MW | 49 kDa |
Protein Sequence |
>RC200461 protein sequence
Red=Cloning site Green=Tags(s) MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWG ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKV ILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVS EWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLA VKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSL QEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPT SQKVGEKVFPIWR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_996845 |
RefSeq Size | 2446 |
RefSeq ORF | 1299 |
Synonyms | HRMT1L1 |
Locus ID | 3275 |
Cytogenetics | 21q22.3 |
Summary | Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400590 | PRMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404196 | PRMT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400590 | Transient overexpression lysate of protein arginine methyltransferase 2 (PRMT2), transcript variant 2 |
CNY 3080.00 |
|
LY404196 | Transient overexpression lysate of protein arginine methyltransferase 2 (PRMT2), transcript variant 1 |
CNY 3080.00 |
|
PH318590 | PRMT2 MS Standard C13 and N15-labeled recombinant protein (NP_001526) |
CNY 19520.00 |
|
TP300461 | Recombinant protein of human protein arginine methyltransferase 2 (PRMT2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP318590 | Recombinant protein of human protein arginine methyltransferase 2 (PRMT2), transcript variant 2, 20 µg |
CNY 2900.00 |