CDC25A (NM_001789) Human Mass Spec Standard
CAT#: PH300496
CDC25A MS Standard C13 and N15-labeled recombinant protein (NP_001780)
View other "CDC25A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | CDC25A MS Standard C13 and N15-labeled recombinant protein (NP_001780) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200496 |
Predicted MW | 59.1 kDa |
Protein Sequence |
>RC200496 protein sequence
Red=Cloning site Green=Tags(s) MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYEQPLEVKNNSN LQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALKRSHSDSLDHDIFQLIDPDEN KENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTAT LSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQ EESPPGSTKRRKSMSGASPKESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTV AGKHQDLKYISPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSYCEPPSYRPMH HEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001780 |
RefSeq Size | 3717 |
RefSeq ORF | 1572 |
Synonyms | CDC25A2 |
Locus ID | 993 |
Cytogenetics | 3p21.31 |
Summary | CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in response to DNA damage, which prevents cells with chromosomal abnormalities from progressing through cell division. CDC25A is an oncogene, although its exact role in oncogenesis has not been demonstrated. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Cell cycle, Progesterone-mediated oocyte maturation |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
CDC25A Protein Stability Represents a Previously Unrecognized Target of HER2 Signaling in Human Breast Cancer: Implication for a Potential Clinical Relevance in Trastuzumab Treatment
,null,
Neoplasia (New York, N.Y.)
,PubMed ID 23730206
[CDC25A]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419746 | CDC25A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419746 | Transient overexpression lysate of cell division cycle 25 homolog A (S. pombe) (CDC25A), transcript variant 1 |
CNY 3080.00 |
|
TP300496 | Recombinant protein of human cell division cycle 25 homolog A (S. pombe) (CDC25A), transcript variant 1, 20 µg |
CNY 2900.00 |