AKR1B1 (NM_001628) Human Mass Spec Standard
CAT#: PH300504
AKR1B1 MS Standard C13 and N15-labeled recombinant protein (NP_001619)
View other "AKR1B1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | AKR1B1 MS Standard C13 and N15-labeled recombinant protein (NP_001619) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200504 |
Predicted MW | 35.7 kDa |
Protein Sequence |
>RC200504 representing NM_001628
Red=Cloning site Green=Tags(s) MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR EELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILD TWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAY SPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFE LSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001619 |
RefSeq Size | 1416 |
RefSeq ORF | 948 |
Synonyms | ADR; ALDR1; ALR2; AR |
Locus ID | 231 |
Cytogenetics | 7q33 |
Summary | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq, Feb 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Fructose and mannose metabolism, Galactose metabolism, Glycerolipid metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419838 | AKR1B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419838 | Transient overexpression lysate of aldo-keto reductase family 1, member B1 (aldose reductase) (AKR1B1) |
CNY 3080.00 |
|
TP300504 | Purified recombinant protein of Homo sapiens aldo-keto reductase family 1, member B1 (aldose reductase) (AKR1B1), 20 µg |
CNY 2900.00 |