P70 S6 Kinase beta (RPS6KB2) (NM_003952) Human Mass Spec Standard
CAT#: PH300525
RPS6KB2 MS Standard C13 and N15-labeled recombinant protein (NP_003943)
View other "P70 S6 Kinase beta" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RPS6KB2 MS Standard C13 and N15-labeled recombinant protein (NP_003943) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200525 |
| Predicted MW | 53.5 kDa |
| Protein Sequence |
>RC200525 protein sequence
Red=Cloning site Green=Tags(s) MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELL RVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQT GGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKL TDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDK IIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQ SEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRV PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRPGR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003943 |
| RefSeq Size | 1782 |
| RefSeq ORF | 1446 |
| Synonyms | KLS; p70(S6K)-beta; P70-beta; P70-beta-1; P70-beta-2; p70S6Kb; S6K-beta2; S6K2; S6KB; S6Kbeta; S6KI(2); SRK; STK14B |
| Locus ID | 6199 |
| Cytogenetics | 11q13.2 |
| Summary | This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq, Jan 2015] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Acute myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Insulin signaling pathway, mTOR signaling pathway, TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401298 | RPS6KB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401298 | Transient overexpression lysate of ribosomal protein S6 kinase, 70kDa, polypeptide 2 (RPS6KB2) |
CNY 3080.00 |
|
| TP300525 | Recombinant protein of human ribosomal protein S6 kinase, 70kDa, polypeptide 2 (RPS6KB2), 20 µg |
CNY 2900.00 |
其它P70 S6 Kinase beta产品
