H2AZ2 (NM_012412) Human Mass Spec Standard
CAT#: PH300564
H2AFV MS Standard C13 and N15-labeled recombinant protein (NP_036544)
View other "H2AZ2" proteins (6)
| Need it in bulk or customized? Get a free quote | 
CNY 19520.00
Specifications
| Product Data | |
| Description | H2AFV MS Standard C13 and N15-labeled recombinant protein (NP_036544) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC200564 | 
| Predicted MW | 13.5 kDa | 
| Protein Sequence | >RC200564 protein sequence Red=Cloning site Green=Tags(s) MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELA GNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_036544 | 
| RefSeq Size | 1429 | 
| RefSeq ORF | 384 | 
| Synonyms | H2A.Z-2; H2AFV; H2AV | 
| Locus ID | 94239 | 
| Cytogenetics | 7p13 | 
| Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq, Oct 2015] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Systemic lupus erythematosus | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC402207 | H2AFV HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC408460 | H2AFV HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY402207 | Transient overexpression lysate of H2A histone family, member V (H2AFV), transcript variant 1 | CNY 3080.00 | |
| LY408460 | Transient overexpression lysate of H2A histone family, member V (H2AFV), transcript variant 2 | CNY 3080.00 | |
| TP300564 | Recombinant protein of human H2A histone family, member V (H2AFV), transcript variant 1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP762602 | Purified recombinant protein of Human H2A histone family, member V (H2AFV), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug | CNY 2480.00 | 

 
                        


 
        