PFDN1 (NM_002622) Human Mass Spec Standard
CAT#: PH300584
PFDN1 MS Standard C13 and N15-labeled recombinant protein (NP_002613)
View other "PFDN1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PFDN1 MS Standard C13 and N15-labeled recombinant protein (NP_002613) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200584 |
| Predicted MW | 14.2 kDa |
| Protein Sequence |
>RC200584 protein sequence
Red=Cloning site Green=Tags(s) MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFIL QSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002613 |
| RefSeq Size | 1324 |
| RefSeq ORF | 366 |
| Synonyms | PDF; PFD1 |
| Locus ID | 5201 |
| Cytogenetics | 5q31.3 |
| Summary | This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419197 | PFDN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419197 | Transient overexpression lysate of prefoldin subunit 1 (PFDN1) |
CNY 3080.00 |
|
| TP300584 | Recombinant protein of human prefoldin subunit 1 (PFDN1), 20 µg |
CNY 2900.00 |
