Calumenin (CALU) (NM_001219) Human Mass Spec Standard
CAT#: PH300589
CALU MS Standard C13 and N15-labeled recombinant protein (NP_001210)
View other "Calumenin" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CALU MS Standard C13 and N15-labeled recombinant protein (NP_001210) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200589 |
| Predicted MW | 37.1 kDa |
| Protein Sequence |
>RC200589 protein sequence
Red=Cloning site Green=Tags(s) MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESK ERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL EEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001210 |
| RefSeq Size | 5366 |
| RefSeq ORF | 945 |
| Locus ID | 813 |
| Cytogenetics | 7q32.1 |
| Summary | The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include reticulocalbin, ERC-55, and Cab45 and the product of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400488 | CALU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427231 | CALU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400488 | Transient overexpression lysate of calumenin (CALU), transcript variant 1 |
CNY 3080.00 |
|
| LY427231 | Transient overexpression lysate of calumenin (CALU), transcript variant 2 |
CNY 3080.00 |
|
| TP300589 | Recombinant protein of human calumenin (CALU), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720752 | Purified recombinant protein of Human calumenin (CALU), transcript variant 1 |
CNY 3140.00 |
其它Calumenin产品
