BCAT2 (NM_001190) Human Mass Spec Standard
CAT#: PH300625
BCAT2 MS Standard C13 and N15-labeled recombinant protein (NP_001181)
View other "BCAT2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BCAT2 MS Standard C13 and N15-labeled recombinant protein (NP_001181) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200625 |
| Predicted MW | 44.3 kDa |
| Protein Sequence |
>RC200625 protein sequence
Red=Cloning site Green=Tags(s) MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEW NDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFD KLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPTRALLFVILCPVGAYFPGGSVTPVS LLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGV LELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRI LYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001181 |
| RefSeq Size | 1616 |
| RefSeq ORF | 1176 |
| Synonyms | BCAM; BCATM; BCT2; HVLI; PP18 |
| Locus ID | 587 |
| Cytogenetics | 19q13.33 |
| Summary | This gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis, Valine, leucine and isoleucine biosynthesis, Valine, leucine and isoleucine degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400477 | BCAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400477 | Transient overexpression lysate of branched chain aminotransferase 2, mitochondrial (BCAT2), nuclear gene encoding mitochondrial protein, transcript variant a |
CNY 3080.00 |
|
| TP300625 | Recombinant protein of human branched chain aminotransferase 2, mitochondrial (BCAT2), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
