POLR2L (NM_021128) Human Mass Spec Standard
CAT#: PH300649
POLR2L MS Standard C13 and N15-labeled recombinant protein (NP_066951)
View other "POLR2L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | POLR2L MS Standard C13 and N15-labeled recombinant protein (NP_066951) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200649 |
| Predicted MW | 7.6 kDa |
| Protein Sequence |
>RC200649 protein sequence
Red=Cloning site Green=Tags(s) MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_066951 |
| RefSeq Size | 925 |
| RefSeq ORF | 201 |
| Synonyms | hRPB7.6; RBP10; RPABC5; RPB7.6; RPB10; RPB10beta |
| Locus ID | 5441 |
| Cytogenetics | 11p15.5 |
| Summary | This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412067 | POLR2L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412067 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L) |
CNY 3080.00 |
|
| TP300649 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa (POLR2L), 20 µg |
CNY 2900.00 |
