POLR2H (NM_006232) Human Mass Spec Standard
CAT#: PH300650
POLR2H MS Standard C13 and N15-labeled recombinant protein (NP_006223)
View other "POLR2H" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | POLR2H MS Standard C13 and N15-labeled recombinant protein (NP_006223) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200650 |
| Predicted MW | 17.1 kDa |
| Protein Sequence |
>RC200650 protein sequence
Red=Cloning site Green=Tags(s) MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTL DDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSR VYLLMKKLAF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006223 |
| RefSeq Size | 1264 |
| RefSeq ORF | 450 |
| Synonyms | RPABC3; RPB8; RPB17 |
| Locus ID | 5437 |
| Cytogenetics | 3q27.1 |
| Summary | The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jul 2013] |
| Protein Families | Transcription Factors |
| Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416788 | POLR2H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416788 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide H (POLR2H) |
CNY 3080.00 |
|
| TP300650 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide H (POLR2H), 20 µg |
CNY 2900.00 |
