S100A11 (NM_005620) Human Mass Spec Standard
CAT#: PH300656
S100A11 MS Standard C13 and N15-labeled recombinant protein (NP_005611)
View other "S100A11" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | S100A11 MS Standard C13 and N15-labeled recombinant protein (NP_005611) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC200656 | 
| Predicted MW | 11.7 kDa | 
| Protein Sequence | 
                 >RC200656 protein sequence 
Red=Cloning site Green=Tags(s) MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN SDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_005611 | 
| RefSeq Size | 595 | 
| RefSeq ORF | 315 | 
| Synonyms | HEL-S-43; MLN70; S100C | 
| Locus ID | 6282 | 
| Cytogenetics | 1q21.3 | 
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. [provided by RefSeq, Jul 2008] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC417184 | S100A11 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY417184 | Transient overexpression lysate of S100 calcium binding protein A11 (S100A11) | 
                                                     CNY 3080.00  | 
                                            |
| TP300656 | Recombinant protein of human S100 calcium binding protein A11 (S100A11), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它S100A11产品
