CD79B (NM_001039933) Human Mass Spec Standard
CAT#: PH300665
CD79B MS Standard C13 and N15-labeled recombinant protein (NP_001035022)
View other "CD79B" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CD79B MS Standard C13 and N15-labeled recombinant protein (NP_001035022) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200665 |
| Predicted MW | 26.05 kDa |
| Protein Sequence |
>RC200665 representing NM_001039933
Red=Cloning site Green=Tags(s) MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSA SGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTEL RVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDI VTLRTGEVKWSVGEHPGQE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035022 |
| RefSeq Size | 1303 |
| RefSeq ORF | 687 |
| Synonyms | AGM6; B29; IGB |
| Locus ID | 974 |
| Cytogenetics | 17q23.3 |
| Summary | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | B cell receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421857 | CD79B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424598 | CD79B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421857 | Transient overexpression lysate of CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3 |
CNY 3080.00 |
|
| LY424598 | Transient overexpression lysate of CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 1 |
CNY 3080.00 |
|
| TP300665 | Recombinant protein of human CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP720747 | Purified recombinant protein of Human CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3 |
CNY 3140.00 |
