NME2 (NM_001018139) Human Mass Spec Standard
CAT#: PH300680
NME2 MS Standard C13 and N15-labeled recombinant protein (NP_001018149)
View other "NME2" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | NME2 MS Standard C13 and N15-labeled recombinant protein (NP_001018149) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200680 |
Predicted MW | 17.3 kDa |
Protein Sequence |
>RC200680 protein sequence
Red=Cloning site Green=Tags(s) MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELV DYKSCAHDWVYE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001018149 |
RefSeq Size | 682 |
RefSeq ORF | 456 |
Synonyms | NDKB; NDPK-B; NDPKB; NM23-H2; NM23B; PUF |
Locus ID | 4831 |
Cytogenetics | 17q21.33 |
Summary | Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419276 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422664 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422665 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422666 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419276 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1 |
CNY 3080.00 |
|
LY422664 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 2 |
CNY 3080.00 |
|
LY422665 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 3 |
CNY 3080.00 |
|
LY422666 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 4 |
CNY 3080.00 |
|
TP300680 | Recombinant protein of human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP760412 | Purified recombinant protein of Human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
TP761637 | Purified recombinant protein of Human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |