PGAM2 (NM_000290) Human Mass Spec Standard
CAT#: PH300701
PGAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000281)
View other "PGAM2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PGAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000281) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200701 |
| Predicted MW | 28.8 kDa |
| Protein Sequence |
>RC200701 protein sequence
Red=Cloning site Green=Tags(s) MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAI LDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKER RYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNL PTGIPIVYELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000281 |
| RefSeq Size | 888 |
| RefSeq ORF | 759 |
| Synonyms | GSD10; PGAM-M; PGAMM |
| Locus ID | 5224 |
| Cytogenetics | 7p13 |
| Summary | Phosphoglycerate mutase (PGAM) catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The PGAM is a dimeric enzyme containing, in different tissues, different proportions of a slow-migrating muscle (MM) isozyme, a fast-migrating brain (BB) isozyme, and a hybrid form (MB). This gene encodes muscle-specific PGAM subunit. Mutations in this gene cause muscle phosphoglycerate mutase eficiency, also known as glycogen storage disease X. [provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424823 | PGAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424823 | Transient overexpression lysate of phosphoglycerate mutase 2 (muscle) (PGAM2) |
CNY 3080.00 |
|
| TP300701 | Recombinant protein of human phosphoglycerate mutase 2 (muscle) (PGAM2), 20 µg |
CNY 2900.00 |
