TTPAL (NM_024331) Human Mass Spec Standard
CAT#: PH300776
TTPAL MS Standard C13 and N15-labeled recombinant protein (NP_077307)
View other "TTPAL" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | TTPAL MS Standard C13 and N15-labeled recombinant protein (NP_077307) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200776 |
| Predicted MW | 38.5 kDa |
| Protein Sequence |
>RC200776 protein sequence
Red=Cloning site Green=Tags(s) MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYP NLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPHTDPRG CHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIG ILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGE LDTATWNAVLLASEDDFVKEFCQPVPACDSILGQTLLPEGLTSDAQCDDSLRAVKSQLYSCY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_077307 |
| RefSeq Size | 6236 |
| RefSeq ORF | 1026 |
| Synonyms | C20orf121 |
| Locus ID | 79183 |
| Cytogenetics | 20q13.12 |
| Summary | May act as a protein that binds a hydrophobic ligand.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411290 | TTPAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422027 | TTPAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411290 | Transient overexpression lysate of tocopherol (alpha) transfer protein-like (TTPAL), transcript variant 1 |
CNY 3080.00 |
|
| LY422027 | Transient overexpression lysate of tocopherol (alpha) transfer protein-like (TTPAL), transcript variant 2 |
CNY 3080.00 |
|
| PH316730 | TTPAL MS Standard C13 and N15-labeled recombinant protein (NP_001034288) |
CNY 19520.00 |
|
| TP300776 | Recombinant protein of human tocopherol (alpha) transfer protein-like (TTPAL), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP316730 | Recombinant protein of human tocopherol (alpha) transfer protein-like (TTPAL), transcript variant 2, 20 µg |
CNY 2900.00 |
