MANBAL (NM_001003897) Human Mass Spec Standard
CAT＃: PH300796
MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_001003897)
View other "MANBAL" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
Specifications
| Product Data | |
| Description | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_001003897) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200796 |
| Predicted MW | 9.5 kDa |
| Protein Sequence |
>RC200796 protein sequence
Red=Cloning site Green=Tags(s) MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV PSVNKRPKKETKKKR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001003897 |
| RefSeq Size | 1268 |
| RefSeq ORF | 255 |
| Locus ID | 63905 |
| Cytogenetics | 20q11.23 |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411800 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424033 | MANBAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411800 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1 |
CNY 3080.00 |
|
| LY424033 | Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2 |
CNY 3080.00 |
|
| PH305099 | MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_071360) |
CNY 19520.00 |
|
| TP300796 | Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP305099 | Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1, 20 µg |
CNY 2900.00 |
