MTMR14 (NM_022485) Human Mass Spec Standard
CAT#: PH300809
MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_071930)
View other "MTMR14" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_071930) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200809 |
| Predicted MW | 60 kDa |
| Protein Sequence |
>RC200809 protein sequence
Red=Cloning site Green=Tags(s) MAGARAAAAAASAGSSASSGNQPPQELGLGELLEEFSRTQYRAKDGSGTGGSKVERIEKRCLELFGRDYC FSVIPNTNGDICGHYPRHIVFLEYESSEKEKDTFESTVQVSKLQDLIHRSKMARCRGRFVCPVILFKGKH ICRSATLAGWGELYGRSGYNYFFSGGADDAWADVEDVTEEDCALRSGDTHLFDKVRGYDIKLLRYLSVKY ICDLMVENKKVKFGMNVTSSEKVDKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAP LSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLLLSLVNSDDDSGLLVHCISGWDRTPLFISLLRLSLWA DGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARD GGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWLAALSDRETRLQ EVRSAFLAAYSSTVGLRAVAPSPSGAIGGLLEQFARGVGLRSISSNAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071930 |
| RefSeq Size | 2200 |
| RefSeq ORF | 1614 |
| Synonyms | C3orf29 |
| Locus ID | 64419 |
| Cytogenetics | 3p25.3 |
| Summary | This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.[provided by RefSeq, Apr 2010] |
| Protein Families | Druggable Genome, Phosphatase, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411652 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421457 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421458 | MTMR14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411652 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 3 |
CNY 3080.00 |
|
| LY421457 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 2 |
CNY 3080.00 |
|
| LY421458 | Transient overexpression lysate of myotubularin related protein 14 (MTMR14), transcript variant 1 |
CNY 3080.00 |
|
| PH307732 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070993) |
CNY 19520.00 |
|
| PH308660 | MTMR14 MS Standard C13 and N15-labeled recombinant protein (NP_001070994) |
CNY 19520.00 |
|
| TP300809 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP307732 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP308660 | Recombinant protein of human myotubularin related protein 14 (MTMR14), transcript variant 1, 20 µg |
CNY 2900.00 |
