RAMAC (NM_031452) Human Mass Spec Standard
CAT#: PH300815
FAM103A1 MS Standard C13 and N15-labeled recombinant protein (NP_113640)
View other "RAMAC" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | FAM103A1 MS Standard C13 and N15-labeled recombinant protein (NP_113640) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC200815 | 
| Predicted MW | 14.4 kDa | 
| Protein Sequence | 
                 >RC200815 protein sequence 
Red=Cloning site Green=Tags(s) MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNR WGWPSDNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_113640 | 
| RefSeq Size | 1588 | 
| RefSeq ORF | 354 | 
| Synonyms | C15orf18; FAM103A1; HsT19360; RAM; RAMMET | 
| Locus ID | 83640 | 
| Cytogenetics | 15q25.2 | 
| Summary | Regulatory subunit of the mRNA-capping methyltransferase RNMT:RAMAC complex that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs (PubMed:22099306, PubMed:27422871). Promotes the recruitment of the methyl donor, S-adenosyl-L-methionine, to RNMT (PubMed:27422871). Regulates RNMT expression by a post-transcriptional stabilizing mechanism (PubMed:22099306). Binds RNA (PubMed:22099306).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC410524 | FAM103A1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY410524 | Transient overexpression lysate of family with sequence similarity 103, member A1 (FAM103A1) | 
                                                     CNY 3080.00  | 
                                            |
| TP300815 | Recombinant protein of human family with sequence similarity 103, member A1 (FAM103A1), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
